"cell_type": "markdown",
"metadata": {},
"source": [
+ "<a name=\"top\"></a>\n",
"# Enigma machine\n",
- "Specification from [Codes and Ciphers](http://www.codesandciphers.org.uk/enigma/rotorspec.htm) page.\n",
"\n",
- "Example Enigma machines from [Louise Dale](http://enigma.louisedade.co.uk/enigma.html) (full simulation) and [EnigmaCo](http://enigmaco.de/enigma/enigma.html) (good animation of the wheels, but no ring settings).\n",
+ "This is an implementation of an Enigma machine in Python. See below for links that describe the Enigma machine and how it was used.\n",
"\n",
- "There's also the nice Enigma simulator for Android by [Franklin Heath](https://franklinheath.co.uk/2012/02/04/our-first-app-published-enigma-simulator/), available on the [Google Play store](https://play.google.com/store/apps/details?id=uk.co.franklinheath.enigmasim&hl=en_GB)."
+ "The Enigma machine has a bunch of components which can be swapped or modified to change its behaviour. The components are:\n",
+ "\n",
+ "* The plugboard\n",
+ "* The wheels (three chosen from a set of five)\n",
+ "* The reflector (two available, though generally not swapped)\n",
+ "\n",
+ "The plugboard and wheel selection were changed every day. The wheel orientation was changed every message.\n",
+ "\n",
+ "## Design sketch\n",
+ "Each of the components can be thought of as a \"letter transformer\", which take a letter and input and give a different letter as output. From a given setup (plugboard setting or wheel orientation), these transformations are deterministic: if nothing moves, the same letter input will give the same letter output. Depending on the component, forward and backward transformations can be different. For instance, the wheel I converts `a` to `e` forward, and `a` to `u` backward.\n",
+ "\n",
+ "This means we can take an object oriented approach to building the Enigma machine. The machine itself is a collection (aggregation) of components. Each component keeps track of its current state. \n",
+ "\n",
+ "The components have an inheritance hierarchy.\n",
+ "\n",
+ "* [LetterTransformer](#lettertransformer)\n",
+ " * [Plugobard](#plugboard)\n",
+ " * [Reflector](#reflector)\n",
+ " * [SimpleWheel](#simplewheel)\n",
+ " * [Wheel](#wheel)\n",
+ "\n",
+ "The `LetterTransformer` is the base class and defines the basic operations all the transformers apply. \n",
+ "\n",
+ "A `Plugboard` is a type of `LetterTransformer` that swaps only some letters, and acts the same both forward and backward. The `Reflector` acts like a `Plugboard` but with 13 pairs of swaps.\n",
+ "\n",
+ "A `SimpleWheel` has different forward and backward transforms, and also rotates. A `Wheel` is the same, but the indicator \"ring\" around the outside can be rotated around the core. This ring of a `Wheel` has a notch that can control when other `SimpleWheel`s and `Wheel`s are rotated in the Enigma.\n",
+ "\n",
+ "Note that all the logic of when the wheels rotate is controlled by the Enigma machine.\n",
+ "\n",
+ "* [Engima](#enigma)\n",
+ "* [Testing Enigma](#testingenigma)\n",
+ "\n",
+ "### Implmentation note\n",
+ "The normal way to define a class in Python is to define all the methods, class variables, and instance variables at the same time. However, that makes it difficult to place the discussion of the various methods and what they do near the definitions. \n",
+ "\n",
+ "This notebook takes a variant approach of defining the base class, then defining methods in separate cells and adding them to the class with the `setattr()` procedure.\n",
+ "\n",
+ "\n",
+ "## See also\n",
+ "* Specification from [Codes and Ciphers](http://www.codesandciphers.org.uk/enigma/rotorspec.htm) page.\n",
+ "\n",
+ "* Example Enigma machines from [Louise Dale](http://enigma.louisedade.co.uk/enigma.html) (full simulation) and [EnigmaCo](http://enigmaco.de/enigma/enigma.html) (good animation of the wheels, but no ring settings).\n",
+ "\n",
+ "* There's also the nice Enigma simulator for Android by [Franklin Heath](https://franklinheath.co.uk/2012/02/04/our-first-app-published-enigma-simulator/), available on the [Google Play store](https://play.google.com/store/apps/details?id=uk.co.franklinheath.enigmasim&hl=en_GB).\n",
+ "\n",
+ "* Enigma wiring from the [Crypto Museum](http://www.cryptomuseum.com/crypto/enigma/wiring.htm)."
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "First, some general-purpose and utility imports. \n",
+ "\n",
+ "`pos` and `unpos` convert between letters and numbers (in range 0-25 inclusive)."
]
},
{
"cell_type": "code",
- "execution_count": 333,
+ "execution_count": 108,
"metadata": {
"collapsed": true
},
"outputs": [],
"source": [
"import string\n",
+ "import collections\n",
+ "\n",
+ "cat = ''.join\n",
"\n",
- "cat = ''.join"
+ "def clean(text): return cat(l.lower() for l in text if l in string.ascii_letters)\n",
+ "\n",
+ "def pos(letter): \n",
+ " if letter in string.ascii_lowercase:\n",
+ " return ord(letter) - ord('a')\n",
+ " elif letter in string.ascii_uppercase:\n",
+ " return ord(letter) - ord('A')\n",
+ " else:\n",
+ " return ''\n",
+ " \n",
+ "def unpos(number): return chr(number % 26 + ord('a'))"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "The wheel specifications show what positions `a` to `z` (ignoring the ring) go to. For instance, Wheel 1 converts `a` to `e` forward, and `a` to `u` backward. The notch positions show where the wheel advance notches are on the wheel rings. The reflector specifications show the reflected pairs."
]
},
{
"cell_type": "code",
- "execution_count": 334,
+ "execution_count": 109,
"metadata": {
"collapsed": true
},
"beta_wheel_spec = 'leyjvcnixwpbqmdrtakzgfuhos'\n",
"gamma_wheel_spec = 'fsokanuerhmbtiycwlqpzxvgjd'\n",
"\n",
- "wheel_i_pegs = ['q']\n",
- "wheel_ii_pegs = ['e']\n",
- "wheel_iii_pegs = ['v']\n",
- "wheel_iv_pegs = ['j']\n",
- "wheel_v_pegs = ['z']\n",
- "wheel_vi_pegs = ['z', 'm']\n",
- "wheel_vii_pegs = ['z', 'm']\n",
- "wheel_viii_pegs = ['z', 'm']\n",
+ "wheel_i_notches = ['q']\n",
+ "wheel_ii_notches = ['e']\n",
+ "wheel_iii_notches = ['v']\n",
+ "wheel_iv_notches = ['j']\n",
+ "wheel_v_notches = ['z']\n",
+ "wheel_vi_notches = ['z', 'm']\n",
+ "wheel_vii_notches = ['z', 'm']\n",
+ "wheel_viii_notches = ['z', 'm']\n",
+ "\n",
+ "reflector_b_spec = 'ay br cu dh eq fs gl ip jx kn mo tz vw'\n",
+ "reflector_c_spec = 'af bv cp dj ei go hy kr lz mx nw tq su'"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 110,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "# class LetterTransformer(object):\n",
+ "# def __init__(self, specification, raw_transform=False):\n",
+ "# if raw_transform:\n",
+ "# transform = specification\n",
+ "# else:\n",
+ "# transform = self.parse_specification(specification)\n",
+ "# self.validate_transform(transform)\n",
+ "# self.make_transform_map(transform)\n",
+ " \n",
+ "# def parse_specification(self, specification):\n",
+ "# return list(zip(string.ascii_lowercase, clean(specification)))\n",
+ "# # return specification\n",
+ " \n",
+ "# def validate_transform(self, transform):\n",
+ "# \"\"\"A set of pairs, of from-to\"\"\"\n",
+ "# if len(transform) != 26:\n",
+ "# raise ValueError(\"Transform specification has {} pairs, requires 26\".\n",
+ "# format(len(transform)))\n",
+ "# for p in transform:\n",
+ "# if len(p) != 2:\n",
+ "# raise ValueError(\"Not all mappings in transform \"\n",
+ "# \"have two elements\")\n",
+ "# if len(set([p[0] for p in transform])) != 26:\n",
+ "# raise ValueError(\"Transform specification must list 26 origin letters\") \n",
+ "# if len(set([p[1] for p in transform])) != 26:\n",
+ "# raise ValueError(\"Transform specification must list 26 destination letters\") \n",
+ "\n",
+ "# def make_empty_transform(self):\n",
+ "# self.forward_map = [0] * 26\n",
+ "# self.backward_map = [0] * 26\n",
+ " \n",
+ "# def make_transform_map(self, transform):\n",
+ "# self.make_empty_transform()\n",
+ "# for p in transform:\n",
+ "# self.forward_map[pos(p[0])] = pos(p[1])\n",
+ "# self.backward_map[pos(p[1])] = pos(p[0])\n",
+ "# return self.forward_map, self.backward_map\n",
+ " \n",
+ "# def forward(self, letter):\n",
+ "# if letter in string.ascii_lowercase:\n",
+ "# return unpos(self.forward_map[pos(letter)])\n",
+ "# else:\n",
+ "# return ''\n",
+ " \n",
+ "# def backward(self, letter):\n",
+ "# if letter in string.ascii_lowercase:\n",
+ "# return unpos(self.backward_map[pos(letter)])\n",
+ "# else:\n",
+ "# return ''"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"lettertransformer\"></a>\n",
+ "# Letter transformer\n",
+ "[Top](#top)\n",
+ "\n",
+ "A generic transformer of letters. All components in the Enigma are based on this. \n",
+ "\n",
+ "The transformer has two directions, `forward` and `backward`. In each direction, a given letter is transformed into a different letter. Both transformations are general permutations of the alphabet (i.e. each letter goes to one and only one new letter). There is no general requirement for the `forward` and `backward` transformations to have any particular relationship to each other (even though most do in the Enigma machine).\n",
"\n",
- "reflector_b_spec = '(ay) (br) (cu) (dh) (eq) (fs) (gl) (ip) (jx) (kn) (mo) (tz) (vw)'\n",
- "reflector_c_spec = '(af) (bv) (cp) (dj) (ei) (go) (hy) (kr) (lz) (mx) (nw) (tq) (su)'"
+ "When created, it must be given the transformation which should be applied. A raw transform is a sequence of letter pairs, such that `p[0]` is transformed to `p[1]` forwards, and `p[1]` goes to `p[0]` backwards.\n",
+ "\n",
+ "If the transform is not raw, it's assumed that the specification is a sequence of the `p[1]`s, and the standard alphabet gives the `p[0]`s."
]
},
{
"cell_type": "code",
- "execution_count": 335,
+ "execution_count": 111,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
" else:\n",
" transform = self.parse_specification(specification)\n",
" self.validate_transform(transform)\n",
- " self.make_transform_map(transform)\n",
- " \n",
- " def parse_specification(self, specification):\n",
- " return specification\n",
- " \n",
- " def validate_transform(self, transform):\n",
- " \"\"\"A set of pairs, of from-to\"\"\"\n",
- " if len(transform) != 26:\n",
- " raise ValueError(\"Transform specification has {} pairs, requires 26\".\n",
- " format(len(transform)))\n",
- " for p in transform:\n",
- " if len(p) != 2:\n",
- " raise ValueError(\"Not all mappings in transform \"\n",
- " \"have two elements\")\n",
- " if len(set([p[0] for p in transform])) != 26:\n",
- " raise ValueError(\"Transform specification must list 26 origin letters\") \n",
- " if len(set([p[1] for p in transform])) != 26:\n",
- " raise ValueError(\"Transform specification must list 26 destination letters\") \n",
- "\n",
- " def make_empty_transform(self):\n",
- " self.forward_map = [0] * 26\n",
- " self.backward_map = [0] * 26\n",
- " \n",
- " def make_transform_map(self, transform):\n",
- " self.make_empty_transform()\n",
- " for p in transform:\n",
- " self.forward_map[ord(p[0]) - ord('a')] = ord(p[1]) - ord('a')\n",
- " self.backward_map[ord(p[1]) - ord('a')] = ord(p[0]) - ord('a')\n",
- " return self.forward_map, self.backward_map\n",
- " \n",
- " def forward(self, letter):\n",
- " if letter in string.ascii_lowercase:\n",
- " return chr(\n",
- " (self.forward_map[(ord(letter) - ord('a')) % 26] + ord('a')))\n",
- " else:\n",
- " return ''\n",
- " \n",
- " def backward(self, letter):\n",
- " if letter in string.ascii_lowercase:\n",
- " return chr(\n",
- " (self.backward_map[(ord(letter) - ord('a')) % 26] + ord('a')))\n",
- " else:\n",
- " return ''"
+ " self.make_transform_map(transform)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Parse a specification: convert a string of destination letters into a list of pairs. "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 112,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def parse_specification(self, specification):\n",
+ " return list(zip(string.ascii_lowercase, clean(specification)))\n",
+ " # return specification\n",
+ "\n",
+ "setattr(LetterTransformer, \"parse_specification\", parse_specification)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 113,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "[('a', 'e'),\n",
+ " ('b', 'k'),\n",
+ " ('c', 'm'),\n",
+ " ('d', 'f'),\n",
+ " ('e', 'l'),\n",
+ " ('f', 'g'),\n",
+ " ('g', 'd'),\n",
+ " ('h', 'q'),\n",
+ " ('i', 'v'),\n",
+ " ('j', 'z'),\n",
+ " ('k', 'n'),\n",
+ " ('l', 't'),\n",
+ " ('m', 'o'),\n",
+ " ('n', 'w'),\n",
+ " ('o', 'y'),\n",
+ " ('p', 'h'),\n",
+ " ('q', 'x'),\n",
+ " ('r', 'u'),\n",
+ " ('s', 's'),\n",
+ " ('t', 'p'),\n",
+ " ('u', 'a'),\n",
+ " ('v', 'i'),\n",
+ " ('w', 'b'),\n",
+ " ('x', 'r'),\n",
+ " ('y', 'c'),\n",
+ " ('z', 'j')]"
+ ]
+ },
+ "execution_count": 113,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "parse_specification(None, wheel_i_spec)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Checks that a transform is valid."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 114,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def validate_transform(self, transform):\n",
+ " \"\"\"A set of pairs, of from-to\"\"\"\n",
+ " if len(transform) != 26:\n",
+ " raise ValueError(\"Transform specification has {} pairs, requires 26\".\n",
+ " format(len(transform)))\n",
+ " for p in transform:\n",
+ " if len(p) != 2:\n",
+ " raise ValueError(\"Not all mappings in transform \"\n",
+ " \"have two elements\")\n",
+ " if len(set([p[0] for p in transform])) != 26:\n",
+ " raise ValueError(\"Transform specification must list 26 origin letters\") \n",
+ " if len(set([p[1] for p in transform])) != 26:\n",
+ " raise ValueError(\"Transform specification must list 26 destination letters\") \n",
+ "\n",
+ "setattr(LetterTransformer, \"validate_transform\", validate_transform) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "The empty transform maps each letter to itself, forward and backward. A useful starting point for creating the maps needed.\n",
+ "\n",
+ "The forward and backward maps are `list`s of numbers (rather than `dict`s of letters to letters) to make the calculations easier when it comes to the wheels, and wheels with turnable indicator rings."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 115,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "# def make_empty_transform(self):\n",
+ "# self.forward_map = [0] * 26\n",
+ "# self.backward_map = [0] * 26\n",
+ "\n",
+ "# setattr(LetterTransformer, \"make_empty_transform\", make_empty_transform) "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 116,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def make_empty_transform(self):\n",
+ " self.forward_map = list(range(26))\n",
+ " self.backward_map = list(range(26))\n",
+ "\n",
+ "setattr(LetterTransformer, \"make_empty_transform\", make_empty_transform) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Make the transform. Starting from an empty transform, mutate it to include the swaps. Note that the forward and backward swaps are stored separately. "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 117,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def make_transform_map(self, transform):\n",
+ " self.make_empty_transform()\n",
+ " for p in transform:\n",
+ " self.forward_map[pos(p[0])] = pos(p[1])\n",
+ " self.backward_map[pos(p[1])] = pos(p[0])\n",
+ " return self.forward_map, self.backward_map\n",
+ "\n",
+ "setattr(LetterTransformer, \"make_transform_map\", make_transform_map)"
]
},
{
"cell_type": "code",
- "execution_count": 336,
+ "execution_count": 118,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
+ "outputs": [],
+ "source": [
+ "def forward(self, letter):\n",
+ " if letter in string.ascii_lowercase:\n",
+ " return unpos(self.forward_map[pos(letter)])\n",
+ " else:\n",
+ " return ''\n",
+ "\n",
+ "def backward(self, letter):\n",
+ " if letter in string.ascii_lowercase:\n",
+ " return unpos(self.backward_map[pos(letter)])\n",
+ " else:\n",
+ " return ''\n",
+ "\n",
+ "setattr(LetterTransformer, \"forward\", forward)\n",
+ "setattr(LetterTransformer, \"backward\", backward) "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 119,
+ "metadata": {},
"outputs": [
{
"data": {
" ('y', 'z')]"
]
},
- "execution_count": 336,
+ "execution_count": 119,
"metadata": {},
"output_type": "execute_result"
}
},
{
"cell_type": "code",
- "execution_count": 337,
+ "execution_count": 120,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'zyxwcabdefghijklmnopqrstuv'"
+ ]
+ },
+ "execution_count": 120,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(collections.OrderedDict.fromkeys('zyxwc' + string.ascii_lowercase))"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 121,
+ "metadata": {
+ "collapsed": true,
+ "scrolled": true
+ },
+ "outputs": [],
+ "source": [
+ "tmap2 = list(zip(string.ascii_lowercase, cat(collections.OrderedDict.fromkeys('zyxwc' + string.ascii_lowercase))))"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 122,
"metadata": {
- "collapsed": false,
"scrolled": true
},
"outputs": [
" 24])"
]
},
- "execution_count": 337,
+ "execution_count": 122,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "lt = LetterTransformer(tmap)\n",
+ "lt = LetterTransformer(tmap, raw_transform = True)\n",
+ "assert(lt.forward_map == [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 0])\n",
+ "assert(lt.backward_map == [25, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24])\n",
"lt.forward_map, lt.backward_map"
]
},
{
"cell_type": "code",
- "execution_count": 338,
- "metadata": {
- "collapsed": false
- },
- "outputs": [
- {
- "data": {
- "text/plain": [
- "'bcdefghijklmnopqrstuvwxyza'"
- ]
- },
- "execution_count": 338,
- "metadata": {},
- "output_type": "execute_result"
- }
- ],
- "source": [
- "cat(lt.forward(l) for l in string.ascii_lowercase)"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 339,
+ "execution_count": 123,
"metadata": {
- "collapsed": false
+ "scrolled": true
},
"outputs": [
{
"data": {
"text/plain": [
- "'zabcdefghijklmnopqrstuvwxy'"
- ]
- },
- "execution_count": 339,
- "metadata": {},
- "output_type": "execute_result"
- }
- ],
- "source": [
- "cat(lt.backward(l) for l in string.ascii_lowercase)"
- ]
+ "([25,\n",
+ " 24,\n",
+ " 23,\n",
+ " 22,\n",
+ " 2,\n",
+ " 0,\n",
+ " 1,\n",
+ " 3,\n",
+ " 4,\n",
+ " 5,\n",
+ " 6,\n",
+ " 7,\n",
+ " 8,\n",
+ " 9,\n",
+ " 10,\n",
+ " 11,\n",
+ " 12,\n",
+ " 13,\n",
+ " 14,\n",
+ " 15,\n",
+ " 16,\n",
+ " 17,\n",
+ " 18,\n",
+ " 19,\n",
+ " 20,\n",
+ " 21],\n",
+ " [5,\n",
+ " 6,\n",
+ " 4,\n",
+ " 7,\n",
+ " 8,\n",
+ " 9,\n",
+ " 10,\n",
+ " 11,\n",
+ " 12,\n",
+ " 13,\n",
+ " 14,\n",
+ " 15,\n",
+ " 16,\n",
+ " 17,\n",
+ " 18,\n",
+ " 19,\n",
+ " 20,\n",
+ " 21,\n",
+ " 22,\n",
+ " 23,\n",
+ " 24,\n",
+ " 25,\n",
+ " 3,\n",
+ " 2,\n",
+ " 1,\n",
+ " 0])"
+ ]
+ },
+ "execution_count": 123,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "lt = LetterTransformer(cat(collections.OrderedDict.fromkeys('zyxwc' + string.ascii_lowercase)))\n",
+ "assert(lt.forward_map == [25, 24, 23, 22, 2, 0, 1, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21])\n",
+ "assert(lt.backward_map == [5, 6, 4, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 3, 2, 1, 0])\n",
+ "assert(cat(lt.forward(l) for l in string.ascii_lowercase) == 'zyxwcabdefghijklmnopqrstuv')\n",
+ "assert(cat(lt.backward(l) for l in string.ascii_lowercase) == 'fgehijklmnopqrstuvwxyzdcba')\n",
+ "lt.forward_map, lt.backward_map"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 124,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'zyxwcabdefghijklmnopqrstuv'"
+ ]
+ },
+ "execution_count": 124,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(lt.forward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 125,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'fgehijklmnopqrstuvwxyzdcba'"
+ ]
+ },
+ "execution_count": 125,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(lt.backward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"plugboard\"></a>\n",
+ "## Plugboard\n",
+ "[Top](#top)\n",
+ "\n",
+ "A `Plugboard` is a `LetterTransformer` that swaps some pairs of letters, and does the same swaps forward and backward."
+ ]
},
{
"cell_type": "code",
- "execution_count": 340,
+ "execution_count": 126,
"metadata": {
"collapsed": true
},
"source": [
"class Plugboard(LetterTransformer):\n",
" def parse_specification(self, specification):\n",
- " return [tuple(p) for p in specification.split()]\n",
+ " return [tuple(clean(p)) for p in specification.split()]\n",
" \n",
" def validate_transform(self, transform):\n",
" \"\"\"A set of pairs, of from-to\"\"\"\n",
" raise ValueError(\"Not all mappings in transform\"\n",
" \"have two elements\")\n",
" \n",
- " def make_empty_transform(self):\n",
- " self.forward_map = list(range(26))\n",
- " self.backward_map = list(range(26))\n",
+ "# def make_empty_transform(self):\n",
+ "# self.forward_map = list(range(26))\n",
+ "# self.backward_map = list(range(26))\n",
" \n",
" def make_transform_map(self, transform):\n",
" expanded_transform = transform + [tuple(reversed(p)) for p in transform]\n",
},
{
"cell_type": "code",
- "execution_count": 341,
+ "execution_count": 127,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
},
{
"cell_type": "code",
- "execution_count": 342,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 128,
+ "metadata": {},
"outputs": [
{
"data": {
"'zycdefghijklmnopqrstuvwxba'"
]
},
- "execution_count": 342,
+ "execution_count": 128,
"metadata": {},
"output_type": "execute_result"
}
},
{
"cell_type": "code",
- "execution_count": 343,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 129,
+ "metadata": {},
"outputs": [
{
"data": {
"'zycdefghijklmnopqrstuvwxba'"
]
},
- "execution_count": 343,
+ "execution_count": 129,
"metadata": {},
"output_type": "execute_result"
}
},
{
"cell_type": "code",
- "execution_count": 344,
+ "execution_count": 130,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
},
{
"cell_type": "code",
- "execution_count": 345,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 131,
+ "metadata": {},
"outputs": [
{
"data": {
"('zycdefghijklmnopqrstuvwxba', 'zycdefghijklmnopqrstuvwxba')"
]
},
- "execution_count": 345,
+ "execution_count": 131,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(pb.forward(l) for l in string.ascii_lowercase), cat(pb.backward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 132,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "('ugcdypblnzkhmisfrqoxavwtej', 'ugcdypblnzkhmisfrqoxavwtej')"
+ ]
+ },
+ "execution_count": 132,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
+ "pb = Plugboard('ua pf rq so ni ey bg hl tx zj'.upper())\n",
+ "assert(pb.forward_map == pb.backward_map)\n",
+ "assert(pb.forward_map == [20, 6, 2, 3, 24, 15, 1, 11, 13, 25, 10, 7, 12, 8, 18, 5, 17, 16, 14, 23, 0, 21, 22, 19, 4, 9])\n",
+ "assert(cat(pb.forward(l) for l in string.ascii_lowercase) == 'ugcdypblnzkhmisfrqoxavwtej')\n",
+ "assert(cat(pb.backward(l) for l in string.ascii_lowercase) == 'ugcdypblnzkhmisfrqoxavwtej')\n",
"cat(pb.forward(l) for l in string.ascii_lowercase), cat(pb.backward(l) for l in string.ascii_lowercase)"
]
},
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"reflector\"></a>\n",
+ "## Reflector\n",
+ "[Top](#top)\n",
+ "\n",
+ "A `Reflector` is a `Plugboard` that takes exactly 13 pairs of letters to swap."
+ ]
+ },
{
"cell_type": "code",
- "execution_count": 346,
+ "execution_count": 133,
"metadata": {
"collapsed": true
},
"outputs": [],
"source": [
"class Reflector(Plugboard):\n",
- " def parse_specification(self, specification):\n",
- " return [tuple(p) for p in specification[1:-1].split(') (')]\n",
- " \n",
" def validate_transform(self, transform):\n",
" if len(transform) != 13:\n",
" raise ValueError(\"Reflector specification has {} pairs, requires 13\".\n",
},
{
"cell_type": "code",
- "execution_count": 347,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 134,
+ "metadata": {},
"outputs": [
{
"data": {
" ('v', 'w')]"
]
},
- "execution_count": 347,
+ "execution_count": 134,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "# reflector_b_text = '(AY) (BR) (CU) (DH) (EQ) (FS) (GL) (IP) (JX) (KN) (MO) (TZ) (VW)'\n",
+ "reflector_b_l = [tuple(clean(p)) for p in reflector_b_spec.split()]\n",
+ "reflector_b_l"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 135,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "reflector_b = Reflector(reflector_b_spec)\n",
+ "assert(reflector_b.forward_map == reflector_b.backward_map)\n",
+ "assert(reflector_b.forward_map == [24, 17, 20, 7, 16, 18, 11, 3, 15, 23, 13, 6, 14, 10, 12, 8, 4, 1, 5, 25, 2, 22, 21, 9, 0, 19])\n",
+ "assert(cat(reflector_b.forward(l) for l in string.ascii_lowercase) == 'yruhqsldpxngokmiebfzcwvjat')\n",
+ "assert(cat(reflector_b.backward(l) for l in string.ascii_lowercase) == 'yruhqsldpxngokmiebfzcwvjat')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 136,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'yruhqsldpxngokmiebfzcwvjat'"
+ ]
+ },
+ "execution_count": 136,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(reflector_b.forward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 137,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "reflector_c = Reflector(reflector_c_spec)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 138,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'fvpjiaoyedrzxwgctkuqsbnmhl'"
+ ]
+ },
+ "execution_count": 138,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "# reflector_b_text = '(AY) (BR) (CU) (DH) (EQ) (FS) (GL) (IP) (JX) (KN) (MO) (TZ) (VW)'\n",
- "reflector_b_l = [tuple(p) for p in reflector_b_spec.lower()[1:-1].split(') (')]\n",
- "reflector_b_l"
+ "cat(reflector_c.forward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"simplewheel\"></a>\n",
+ "## SimpleWheel\n",
+ "[Top](#top)\n",
+ "\n",
+ "A `SimpleWheel` has different forward and backward maps, and also a position. The position is set with the `set_position` method (and initially in the creator), and the wheel can advance using the `advance` method. \n",
+ "\n",
+ "How the position is used is best explained with an example. The Enigma wheel 1, in the neutral position, transforms `a` to `e` (+4 letters) and `b` to `k` (+10 letters). When the wheel is in position `b` and an `a` in enciphered, it's the _second_ element of the map that's used, so `a` would be advanced 10 letters, to give `j`.\n",
+ "\n",
+ "This means that when using the letter transformation maps, you use the element in the map that's offset by the position of the wheel. When enciphering a `c`, you'd normally use transformation at position 2 in the map; if the wheel is in position 7, you'd instead use the transform at position 2 + 7 = 9 in the map.\n",
+ "\n",
+ "There are various modulus operators to keep the numbers in the requried range, meaning you can wrap around the map and around the wheel.\n",
+ "\n",
+ "Note the use of `__getattribute__` to give a more human-friendly version of the position without making it a method call. That allows you to write `wheel.position` and `wheel.position_l` and get the appropriate answers."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 139,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "class SimpleWheel(LetterTransformer):\n",
+ " def __init__(self, transform, position='a', raw_transform=False):\n",
+ " super(SimpleWheel, self).__init__(transform, raw_transform)\n",
+ " self.set_position(position)\n",
+ " \n",
+ " def __getattribute__(self, name):\n",
+ " if name=='position_l':\n",
+ " return unpos(self.position)\n",
+ " else:\n",
+ " return object.__getattribute__(self, name) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Set the wheel to a new position. Note that it expects a letter, not a number."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 140,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def set_position(self, position):\n",
+ " self.position = ord(position) - ord('a')\n",
+ " \n",
+ "setattr(SimpleWheel, 'set_position', set_position) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Advance the wheel one step. Note that advancing beyond position 25 moves back to 0."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 141,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def advance(self):\n",
+ " self.position = (self.position + 1) % 26\n",
+ " return self.position\n",
+ "\n",
+ "setattr(SimpleWheel, 'advance', advance) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Do the encipherment forward and backward. Note how the map element to use is affected by the wheel position, and how the modulus wraps that map element around the wheel if needed."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 142,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def forward(self, letter):\n",
+ " if letter in string.ascii_lowercase:\n",
+ " return unpos((self.forward_map[(pos(letter) + self.position) % 26] - self.position))\n",
+ " else:\n",
+ " return ''\n",
+ "\n",
+ "def backward(self, letter):\n",
+ " if letter in string.ascii_lowercase:\n",
+ " return unpos((self.backward_map[(pos(letter) + self.position) % 26] - self.position))\n",
+ " else:\n",
+ " return ''\n",
+ " \n",
+ "setattr(SimpleWheel, 'forward', forward) \n",
+ "setattr(SimpleWheel, 'backward', backward) "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 143,
+ "metadata": {
+ "scrolled": true
+ },
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "[('a', 'e'),\n",
+ " ('b', 'k'),\n",
+ " ('c', 'm'),\n",
+ " ('d', 'f'),\n",
+ " ('e', 'l'),\n",
+ " ('f', 'g'),\n",
+ " ('g', 'd'),\n",
+ " ('h', 'q'),\n",
+ " ('i', 'v'),\n",
+ " ('j', 'z'),\n",
+ " ('k', 'n'),\n",
+ " ('l', 't'),\n",
+ " ('m', 'o'),\n",
+ " ('n', 'w'),\n",
+ " ('o', 'y'),\n",
+ " ('p', 'h'),\n",
+ " ('q', 'x'),\n",
+ " ('r', 'u'),\n",
+ " ('s', 's'),\n",
+ " ('t', 'p'),\n",
+ " ('u', 'a'),\n",
+ " ('v', 'i'),\n",
+ " ('w', 'b'),\n",
+ " ('x', 'r'),\n",
+ " ('y', 'c'),\n",
+ " ('z', 'j')]"
+ ]
+ },
+ "execution_count": 143,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "rotor_1_transform = list(zip(string.ascii_lowercase, 'EKMFLGDQVZNTOWYHXUSPAIBRCJ'.lower()))\n",
+ "rotor_1_transform"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 144,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "rotor_1_transform = list(zip(string.ascii_lowercase, 'EKMFLGDQVZNTOWYHXUSPAIBRCJ'.lower()))\n",
+ "wheel_1 = SimpleWheel(rotor_1_transform, raw_transform=True)\n",
+ "assert(cat(wheel_1.forward(l) for l in string.ascii_lowercase) == 'ekmflgdqvzntowyhxuspaibrcj')\n",
+ "assert(cat(wheel_1.backward(l) for l in string.ascii_lowercase) == 'uwygadfpvzbeckmthxslrinqoj')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 145,
+ "metadata": {
+ "scrolled": true
+ },
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "[4,\n",
+ " 10,\n",
+ " 12,\n",
+ " 5,\n",
+ " 11,\n",
+ " 6,\n",
+ " 3,\n",
+ " 16,\n",
+ " 21,\n",
+ " 25,\n",
+ " 13,\n",
+ " 19,\n",
+ " 14,\n",
+ " 22,\n",
+ " 24,\n",
+ " 7,\n",
+ " 23,\n",
+ " 20,\n",
+ " 18,\n",
+ " 15,\n",
+ " 0,\n",
+ " 8,\n",
+ " 1,\n",
+ " 17,\n",
+ " 2,\n",
+ " 9]"
+ ]
+ },
+ "execution_count": 145,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_1.forward_map"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 146,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'j'"
+ ]
+ },
+ "execution_count": 146,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_1.advance()\n",
+ "wheel_1.forward('a')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 147,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "('jlekfcpuymsnvxgwtrozhaqbid', 'vxfzceouyadbjlsgwrkqhmpnit')"
+ ]
+ },
+ "execution_count": 147,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(wheel_1.forward(l) for l in string.ascii_lowercase), cat(wheel_1.backward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 148,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'b'"
+ ]
+ },
+ "execution_count": 148,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_1.position_l"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 149,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "wheel_2 = SimpleWheel(wheel_ii_spec)\n",
+ "assert(cat(wheel_2.forward(l) for l in string.ascii_lowercase) == 'ajdksiruxblhwtmcqgznpyfvoe')\n",
+ "assert(cat(wheel_2.backward(l) for l in string.ascii_lowercase) == 'ajpczwrlfbdkotyuqgenhxmivs')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 150,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "('ajdksiruxblhwtmcqgznpyfvoe', 'ajpczwrlfbdkotyuqgenhxmivs')"
+ ]
+ },
+ "execution_count": 150,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "cat(wheel_2.forward(l) for l in string.ascii_lowercase), cat(wheel_2.backward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 151,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "('bdfhjlcprtxvznyeiwgakmusqo', 'tagbpcsdqeufvnzhyixjwlrkom')"
+ ]
+ },
+ "execution_count": 151,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_3 = SimpleWheel(wheel_iii_spec)\n",
+ "wheel_3.set_position('a')\n",
+ "wheel_3.advance()\n",
+ "assert(cat(wheel_3.forward(l) for l in string.ascii_lowercase) == 'cegikboqswuymxdhvfzjltrpna')\n",
+ "assert(cat(wheel_3.backward(l) for l in string.ascii_lowercase) == 'zfaobrcpdteumygxhwivkqjnls')\n",
+ "assert(wheel_3.position == 1)\n",
+ "assert(wheel_3.position_l == 'b')\n",
+ "\n",
+ "for _ in range(24): wheel_3.advance()\n",
+ "assert(wheel_3.position == 25)\n",
+ "assert(wheel_3.position_l == 'z')\n",
+ "assert(cat(wheel_3.forward(l) for l in string.ascii_lowercase) == 'pcegikmdqsuywaozfjxhblnvtr')\n",
+ "assert(cat(wheel_3.backward(l) for l in string.ascii_lowercase) == 'nubhcqdterfvgwoaizjykxmslp')\n",
+ "\n",
+ "wheel_3.advance()\n",
+ "assert(wheel_3.position == 0)\n",
+ "assert(wheel_3.position_l == 'a')\n",
+ "assert(cat(wheel_3.forward(l) for l in string.ascii_lowercase) == 'bdfhjlcprtxvznyeiwgakmusqo')\n",
+ "assert(cat(wheel_3.backward(l) for l in string.ascii_lowercase) == 'tagbpcsdqeufvnzhyixjwlrkom')\n",
+ "\n",
+ "cat(wheel_3.forward(l) for l in string.ascii_lowercase), cat(wheel_3.backward(l) for l in string.ascii_lowercase)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"wheel\"></a>\n",
+ "## Wheel\n",
+ "[Top](#top)\n",
+ "\n",
+ "This is the same as a `SimpleWheel`, but with the addition of a ring.\n",
+ "\n",
+ "The ring is moveable around the core of the wheel (with the wiring). This means that moving the ring changes the orientation of the core and wiring for the same setting.\n",
+ "\n",
+ "| Wheel with notch | Notch showing peg to hold it in place |\n",
+ "| ---------------- | ------------------------------------- |\n",
+ "| <img src=\"enigma-notch.jpg\" alt=\"Enigma wheel with notch\" width=300> | <img src=\"dtu_notch_big.jpg\" alt=\"Enigma wheel with notch\" width=300> |\n",
+ "| (From [Crypto museum](http://www.cryptomuseum.com/crypto/enigma/img/300879/035/full.jpg)) | From [Matematik Sider](http://www.matematiksider.dk/enigma/dtu_notch_big.jpg) |\n",
+ "\n",
+ "Though it's not very visible in the right hand image, the extra metal below the ring shows a spring-loaded peg on the wheel core which drops into the ring, with one hole per letter. The ring setting is where the peg drops into the ring.\n",
+ "\n",
+ "The notch setting is used in the full Enigma to control when the wheels step forward.\n",
+ "\n",
+ "Note that the constructor calls the superclass's constructor, then sets the positions properly with a call to `set_position`."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 152,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "class Wheel(SimpleWheel):\n",
+ " def __init__(self, transform, ring_notch_letters, ring_setting=1, position='a', raw_transform=False):\n",
+ " self.ring_notch_letters = ring_notch_letters\n",
+ " self.ring_setting = ring_setting\n",
+ " super(Wheel, self).__init__(transform, position=position, raw_transform=raw_transform)\n",
+ " self.set_position(position)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "The `position` of the wheel is the orientation of the core. It's the same as the ring if the ring setting is 1. The `position_l` attribute is used to report the position of the ring letter, which is what the Enigma operator would see. "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 153,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "def __getattribute__(self,name):\n",
+ " if name=='position_l':\n",
+ " return unpos(self.position + self.ring_setting - 1)\n",
+ " else:\n",
+ " return object.__getattribute__(self, name)\n",
+ "\n",
+ "def set_position(self, position):\n",
+ "# self.position = (pos(position) - self.ring_setting + 1) % 26\n",
+ " if isinstance(position, str):\n",
+ " self.position = (pos(position) - self.ring_setting + 1) % 26\n",
+ " else:\n",
+ " self.position = (position - self.ring_setting) % 26\n",
+ "# self.notch_positions = [(pos(position) - pos(p)) % 26 for p in self.ring_notch_letters]\n",
+ " self.notch_positions = [(self.position + self.ring_setting - 1 - pos(p)) % 26 for p in self.ring_notch_letters]\n",
+ " \n",
+ "setattr(Wheel, '__getattribute__', __getattribute__) \n",
+ "setattr(Wheel, 'set_position', set_position) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Advance the wheel. Again, note the superclass call, followed by the update of the notch positions."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 154,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def advance(self):\n",
+ " super(Wheel, self).advance()\n",
+ " self.notch_positions = [(p + 1) % 26 for p in self.notch_positions]\n",
+ " # self.position_l = unpos(self.position + self.ring_setting - 1)\n",
+ " return self.position\n",
+ " \n",
+ "setattr(Wheel, 'advance', advance) "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 155,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "wheel_3 = Wheel(wheel_iii_spec, wheel_iii_notches, position='b', ring_setting=1)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 156,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "(1, [6])"
+ ]
+ },
+ "execution_count": 156,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_3.position, wheel_3.notch_positions"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 157,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "(25, [2, 15])"
+ ]
+ },
+ "execution_count": 157,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_6 = Wheel(wheel_vi_spec, wheel_vi_notches, position='b', ring_setting=3)\n",
+ "wheel_6.position, wheel_6.notch_positions"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 158,
+ "metadata": {
+ "scrolled": true
+ },
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "0 [3, 16]\n",
+ "1 [4, 17]\n",
+ "2 [5, 18]\n",
+ "3 [6, 19]\n",
+ "4 [7, 20]\n",
+ "5 [8, 21]\n",
+ "6 [9, 22]\n",
+ "7 [10, 23]\n",
+ "8 [11, 24]\n",
+ "9 [12, 25]\n",
+ "10 [13, 0]\n",
+ "11 [14, 1]\n",
+ "12 [15, 2]\n",
+ "13 [16, 3]\n",
+ "14 [17, 4]\n",
+ "15 [18, 5]\n",
+ "16 [19, 6]\n",
+ "17 [20, 7]\n",
+ "18 [21, 8]\n",
+ "19 [22, 9]\n",
+ "20 [23, 10]\n",
+ "21 [24, 11]\n",
+ "22 [25, 12]\n",
+ "23 [0, 13]\n",
+ "24 [1, 14]\n",
+ "25 [2, 15]\n",
+ "0 [3, 16]\n"
+ ]
+ }
+ ],
+ "source": [
+ "for _ in range(27):\n",
+ " wheel_6.advance()\n",
+ " print(wheel_6.position, wheel_6.notch_positions)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 159,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "wheel = Wheel(wheel_iii_spec, wheel_iii_notches, position='b', \n",
+ " ring_setting=3)\n",
+ "wheel.set_position(12)\n",
+ "assert(wheel.position == 9)\n",
+ "assert(16 in wheel.notch_positions)\n",
+ "assert(wheel.position_l =='l')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 160,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "[16]"
+ ]
+ },
+ "execution_count": 160,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel.notch_positions"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 161,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'l'"
+ ]
+ },
+ "execution_count": 161,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel.position_l"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 162,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "wheel_3 = Wheel(wheel_iii_spec, wheel_iii_notches, position='b', ring_setting=1)\n",
+ "assert(wheel_3.position == 1)\n",
+ "assert(wheel_3.notch_positions == [6])\n",
+ "assert(wheel_3.position_l == 'b')\n",
+ "wheel_3.advance()\n",
+ "assert(wheel_3.position == 2)\n",
+ "assert(wheel_3.notch_positions == [7])\n",
+ "assert(wheel_3.position_l == 'c')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 163,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "[2, 15]"
+ ]
+ },
+ "execution_count": 163,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_6 = Wheel(wheel_vi_spec, wheel_vi_notches, position='b', ring_setting=3)\n",
+ "wheel_6.notch_positions"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 164,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "wheel_6 = Wheel(wheel_vi_spec, wheel_vi_notches, position='b', ring_setting=3)\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'xkqhwpvngzrcfoiaselbtymjdu')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'ptlyrmidoxbswhnfckquzgeavj')\n",
+ "assert(wheel_6.position == 25)\n",
+ "assert(2 in wheel_6.notch_positions)\n",
+ "assert(15 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'b')\n",
+ "\n",
+ "wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'jpgvoumfyqbenhzrdkasxlictw')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'skxqlhcnwarvgmebjptyfdzuio')\n",
+ "assert(wheel_6.position == 0)\n",
+ "assert(3 in wheel_6.notch_positions)\n",
+ "assert(16 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'c')\n",
+ "\n",
+ "for _ in range(22): wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'mgxantkzsyqjcufirldvhoewbp')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'dymswobuplgraevzkqifntxcjh')\n",
+ "assert(wheel_6.position == 22)\n",
+ "assert(25 in wheel_6.notch_positions)\n",
+ "assert(12 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'y')\n",
+ "\n",
+ "wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'fwzmsjyrxpibtehqkcugndvaol')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'xlrvnatokfqzduyjphemswbigc')\n",
+ "assert(wheel_6.position == 23)\n",
+ "assert(0 in wheel_6.notch_positions)\n",
+ "assert(13 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'z')\n",
+ "\n",
+ "wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'vylrixqwohasdgpjbtfmcuznke')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'kqumzsnjepyctxiogdlrvahfbw')\n",
+ "assert(wheel_6.position == 24)\n",
+ "assert(1 in wheel_6.notch_positions)\n",
+ "assert(14 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'a')\n",
+ "\n",
+ "wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'xkqhwpvngzrcfoiaselbtymjdu')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'ptlyrmidoxbswhnfckquzgeavj')\n",
+ "assert(wheel_6.position == 25)\n",
+ "assert(2 in wheel_6.notch_positions)\n",
+ "assert(15 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'b')\n",
+ "\n",
+ "wheel_6.advance()\n",
+ "assert(cat(wheel_6.forward(l) for l in string.ascii_lowercase) == 'jpgvoumfyqbenhzrdkasxlictw')\n",
+ "assert(cat(wheel_6.backward(l) for l in string.ascii_lowercase) == 'skxqlhcnwarvgmebjptyfdzuio')\n",
+ "assert(wheel_6.position == 0)\n",
+ "assert(3 in wheel_6.notch_positions)\n",
+ "assert(16 in wheel_6.notch_positions)\n",
+ "assert(wheel_6.position_l == 'c')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 165,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "(0, 'c', [3, 16])"
+ ]
+ },
+ "execution_count": 165,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
+ "source": [
+ "wheel_6.position, wheel_6.position_l, wheel_6.notch_positions"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"enigma\"></a>\n",
+ "## Enigma\n",
+ "[Top](#top)\n",
+ "\n",
+ "This is the full Enigma machine.\n",
+ "\n",
+ "It's a collection of the various components defined above. There are three wheels (left, middle, and right), a plugboard, and a reflector.\n",
+ "\n",
+ "The `__getattribute__` method returns the state of the machine in friendly form, generally by asking the components to return the relevant attributes."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 167,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "class Enigma(object):\n",
+ " def __init__(self, reflector_spec,\n",
+ " left_wheel_spec, left_wheel_notches,\n",
+ " middle_wheel_spec, middle_wheel_notches,\n",
+ " right_wheel_spec, right_wheel_notches,\n",
+ " left_ring_setting, middle_ring_setting, right_ring_setting,\n",
+ " plugboard_setting):\n",
+ " self.reflector = Reflector(reflector_spec)\n",
+ " self.left_wheel = Wheel(left_wheel_spec, left_wheel_notches, ring_setting=left_ring_setting)\n",
+ " self.middle_wheel = Wheel(middle_wheel_spec, middle_wheel_notches, ring_setting=middle_ring_setting)\n",
+ " self.right_wheel = Wheel(right_wheel_spec, right_wheel_notches, ring_setting=right_ring_setting)\n",
+ " self.plugboard = Plugboard(plugboard_setting)\n",
+ " \n",
+ " def __getattribute__(self,name):\n",
+ " if name=='wheel_positions':\n",
+ " return self.left_wheel.position, self.middle_wheel.position, self.right_wheel.position \n",
+ " elif name=='wheel_positions_l':\n",
+ " return self.left_wheel.position_l, self.middle_wheel.position_l, self.right_wheel.position_l \n",
+ " elif name=='notch_positions':\n",
+ " return (self.left_wheel.notch_positions, \n",
+ " self.middle_wheel.notch_positions, \n",
+ " self.right_wheel.notch_positions)\n",
+ " else:\n",
+ " return object.__getattribute__(self, name)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Set the wheels to the initial positions. "
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 168,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def set_wheels(self, left_wheel_position, middle_wheel_position, right_wheel_position):\n",
+ " self.left_wheel.set_position(left_wheel_position)\n",
+ " self.middle_wheel.set_position(middle_wheel_position)\n",
+ " self.right_wheel.set_position(right_wheel_position)\n",
+ "\n",
+ "setattr(Enigma, 'set_wheels', set_wheels)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "`lookup` just follows a path through the machine without changing the positions of any parts. It just follows a signal from the input, thorough all the components, to the reflector, back through all the components, to the output."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 169,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def lookup(self, letter):\n",
+ " a = self.plugboard.forward(letter)\n",
+ " b = self.right_wheel.forward(a)\n",
+ " c = self.middle_wheel.forward(b)\n",
+ " d = self.left_wheel.forward(c)\n",
+ " e = self.reflector.forward(d)\n",
+ " f = self.left_wheel.backward(e)\n",
+ " g = self.middle_wheel.backward(f)\n",
+ " h = self.right_wheel.backward(g)\n",
+ " i = self.plugboard.backward(h)\n",
+ " return i\n",
+ "\n",
+ "setattr(Enigma, 'lookup', lookup)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "`advance` moves the wheels on one step. The right wheel always advances. If the notch is in the zero position, the wheel also advances the wheel to the left. \n",
+ "\n",
+ "It follows the 'double stepping' behaviour of the engima machines."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 170,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def advance(self):\n",
+ " advance_middle = False\n",
+ " advance_left = False\n",
+ " if 0 in self.right_wheel.notch_positions:\n",
+ " advance_middle = True\n",
+ " if 0 in self.middle_wheel.notch_positions:\n",
+ " advance_left = True\n",
+ " advance_middle = True\n",
+ " self.right_wheel.advance()\n",
+ " if advance_middle: self.middle_wheel.advance()\n",
+ " if advance_left: self.left_wheel.advance()\n",
+ "\n",
+ "setattr(Enigma, 'advance', advance) "
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Finally, encipher letters and messages. \n",
+ "\n",
+ "Note that the wheels advance _before_ the letter signal is sent through the machine: in the physical machine, the advancing is done by pressing the key on the keyboard. \n",
+ "\n",
+ "Also note that the messages are cleaned before use, so letters are converted to lower case and non-letters are removed."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 220,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "def encipher_letter(self, letter):\n",
+ " self.advance()\n",
+ " return self.lookup(letter)\n",
+ "\n",
+ "def encipher(self, message, debug=False):\n",
+ " enciphered = ''\n",
+ " for letter in clean(message):\n",
+ " enciphered += self.encipher_letter(letter)\n",
+ " if debug:\n",
+ " print('Wheels now', list(self.wheel_positions_l), 'enciphering {} -> {}'.format(letter, self.lookup(letter)))\n",
+ " return enciphered\n",
+ "\n",
+ "setattr(Enigma, 'encipher_letter', encipher_letter)\n",
+ "setattr(Enigma, 'encipher', encipher)\n",
+ "setattr(Enigma, 'decipher', encipher)"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "<a name=\"testingenigma\"></a>\n",
+ "## Testing Enigma\n",
+ "[Top](#top)\n",
+ "\n",
+ "Some tests of the Enigma machine."
]
},
{
"cell_type": "code",
- "execution_count": 348,
+ "execution_count": 172,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
- "reflector_b = Reflector(reflector_b_spec, raw_transform=False)"
+ "enigma = Enigma(reflector_b_spec, \n",
+ " wheel_i_spec, wheel_i_notches,\n",
+ " wheel_ii_spec, wheel_ii_notches,\n",
+ " wheel_iii_spec, wheel_iii_notches,\n",
+ " 1, 1, 1,\n",
+ " '')"
]
},
{
"cell_type": "code",
- "execution_count": 349,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 173,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'yruhqsldpxngokmiebfzcwvjat'"
+ "'u'"
]
},
- "execution_count": 349,
+ "execution_count": 173,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "cat(reflector_b.forward(l) for l in string.ascii_lowercase)"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 350,
- "metadata": {
- "collapsed": true
- },
- "outputs": [],
- "source": [
- "reflector_c = Reflector(reflector_c_spec)"
+ "enigma.lookup('a')"
]
},
{
"cell_type": "code",
- "execution_count": 351,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 174,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'fvpjiaoyedrzxwgctkuqsbnmhl'"
+ "'a'"
]
},
- "execution_count": 351,
+ "execution_count": 174,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "cat(reflector_c.forward(l) for l in string.ascii_lowercase)"
+ "enigma.lookup('u')"
]
},
{
"cell_type": "code",
- "execution_count": 352,
- "metadata": {
- "collapsed": true
- },
- "outputs": [],
+ "execution_count": 175,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'uejobtpzwcnsrkdgvmlfaqiyxh'"
+ ]
+ },
+ "execution_count": 175,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
"source": [
- "class SimpleWheel(LetterTransformer):\n",
- " def __init__(self, transform, position='a', raw_transform=False):\n",
- " super(SimpleWheel, self).__init__(transform, raw_transform)\n",
- " self.set_position(position)\n",
- " \n",
- " def parse_specification(self, specification):\n",
- " return list(zip(string.ascii_lowercase, specification))\n",
- " \n",
- " def set_position(self, position):\n",
- " self.position = ord(position) - ord('a')\n",
- " self.position_l = position\n",
- " \n",
- " def forward(self, letter):\n",
- " if letter in string.ascii_lowercase:\n",
- " return chr(\n",
- " (self.forward_map[(ord(letter) - ord('a') + self.position) % 26] - \n",
- " self.position) % 26 + \n",
- " ord('a'))\n",
- " else:\n",
- " return ''\n",
- " \n",
- " def backward(self, letter):\n",
- " if letter in string.ascii_lowercase:\n",
- " return chr(\n",
- " (self.backward_map[(ord(letter) - ord('a') + self.position) % 26] - \n",
- " self.position) % 26 + \n",
- " ord('a'))\n",
- " else:\n",
- " return ''\n",
- " \n",
- " def advance(self):\n",
- " self.position = (self.position + 1) % 26\n",
- " self.position_l = chr(self.position + ord('a'))\n",
- " return self.position"
+ "cat(enigma.lookup(l) for l in string.ascii_lowercase)"
]
},
{
"cell_type": "code",
- "execution_count": 353,
- "metadata": {
- "collapsed": false,
- "scrolled": true
- },
+ "execution_count": 176,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "[('a', 'e'),\n",
- " ('b', 'k'),\n",
- " ('c', 'm'),\n",
- " ('d', 'f'),\n",
- " ('e', 'l'),\n",
- " ('f', 'g'),\n",
- " ('g', 'd'),\n",
- " ('h', 'q'),\n",
- " ('i', 'v'),\n",
- " ('j', 'z'),\n",
- " ('k', 'n'),\n",
- " ('l', 't'),\n",
- " ('m', 'o'),\n",
- " ('n', 'w'),\n",
- " ('o', 'y'),\n",
- " ('p', 'h'),\n",
- " ('q', 'x'),\n",
- " ('r', 'u'),\n",
- " ('s', 's'),\n",
- " ('t', 'p'),\n",
- " ('u', 'a'),\n",
- " ('v', 'i'),\n",
- " ('w', 'b'),\n",
- " ('x', 'r'),\n",
- " ('y', 'c'),\n",
- " ('z', 'j')]"
+ "'abcdefghijklmnopqrstuvwxyz'"
]
},
- "execution_count": 353,
+ "execution_count": 176,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "rotor_1_transform = list(zip(string.ascii_lowercase, 'EKMFLGDQVZNTOWYHXUSPAIBRCJ'.lower()))\n",
- "rotor_1_transform"
+ "cat(enigma.lookup(enigma.lookup(l)) for l in string.ascii_lowercase)"
]
},
{
"cell_type": "code",
- "execution_count": 354,
+ "execution_count": 177,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
- "wheel_1 = SimpleWheel(rotor_1_transform, raw_transform=True)"
+ "assert(cat(enigma.lookup(enigma.lookup(l)) for l in string.ascii_lowercase) == string.ascii_lowercase)"
]
},
{
"cell_type": "code",
- "execution_count": 355,
+ "execution_count": 178,
"metadata": {
- "collapsed": false
+ "scrolled": true
},
"outputs": [
{
- "data": {
- "text/plain": [
- "('ekmflgdqvzntowyhxuspaibrcj', 'uwygadfpvzbeckmthxslrinqoj')"
- ]
- },
- "execution_count": 355,
- "metadata": {},
- "output_type": "execute_result"
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "0 :: a a a ; [10] [22] [5] uejobtpzwcnsrkdgvmlfaqiyxh\n",
+ "1 :: a a b ; [10] [22] [6] baqmfexihswpdytlcvjozrkgnu\n",
+ "2 :: a a c ; [10] [22] [7] djralkwpobfeyqihncxzvugsmt\n",
+ "3 :: a a d ; [10] [22] [8] zlejcuitgdmbkonsvxphfqyrwa\n",
+ "4 :: a a e ; [10] [22] [9] gcblwtakqzhdosmxiunfryepvj\n",
+ "5 :: a a f ; [10] [22] [10] osnirgfmdpvuhcajwebxlkqtzy\n",
+ "6 :: a a g ; [10] [22] [11] wymvnqzjlhoicekuftxrpdasbg\n",
+ "7 :: a a h ; [10] [22] [12] cjafkdztpbeuormiwnvhlsqyxg\n",
+ "8 :: a a i ; [10] [22] [13] xijuyslvbczgnmqwotfrdhpaek\n",
+ "9 :: a a j ; [10] [22] [14] lfzrwbytjisaovmuxdkhpneqgc\n",
+ "10 :: a a k ; [10] [22] [15] tkezcqynuwbpvhslfxoaimjrgd\n",
+ "11 :: a a l ; [10] [22] [16] kiwfnduxbsaotelqpvjmgrchzy\n",
+ "12 :: a a m ; [10] [22] [17] sfkutbpoxycrnmhgwlaedzqijv\n",
+ "13 :: a a n ; [10] [22] [18] baqwlkhgrsfextpocijnvudmzy\n",
+ "14 :: a a o ; [10] [22] [19] teofbdzxqkjyrscvimnawpuhlg\n",
+ "15 :: a a p ; [10] [22] [20] mhypswrbzxqvaondkgeutlfjci\n",
+ "16 :: a a q ; [10] [22] [21] cpasnrhgkuixzevbyfdwjotlqm\n",
+ "17 :: a a r ; [10] [22] [22] dlfatcjwygvbnmzrxpueskhqio\n",
+ "18 :: a a s ; [10] [22] [23] lxymzjuqtfpadsrkhonigwvbce\n",
+ "19 :: a a t ; [10] [22] [24] puvioztjdhxmlyeawsrgbcqknf\n",
+ "20 :: a a u ; [10] [22] [25] baigpldqcowfyzjehvtsxrkumn\n",
+ "21 :: a a v ; [10] [22] [0] mnvfydiwgzsoablrxpkutchqej\n",
+ "22 :: a b w ; [10] [23] [1] ulfopcykswhbzvderqixanjtgm\n",
+ "23 :: a b x ; [10] [23] [2] qmwftdyovursbzhxaklejicpgn\n",
+ "24 :: a b y ; [10] [23] [3] oljmzxrvucybdqasngpwihtfke\n",
+ "25 :: a b z ; [10] [23] [4] fwevcalzxutgysrqponkjdbimh\n"
+ ]
}
],
"source": [
- "cat(wheel_1.forward(l) for l in string.ascii_lowercase), cat(wheel_1.backward(l) for l in string.ascii_lowercase)"
+ "# check the middle wheel turns over\n",
+ "enigma.set_wheels('a', 'a', 'a')\n",
+ "for i in range(26):\n",
+ " print(i, '::', \n",
+ " enigma.left_wheel.position_l, enigma.middle_wheel.position_l, enigma.right_wheel.position_l, ';',\n",
+ " enigma.left_wheel.notch_positions, enigma.middle_wheel.notch_positions, enigma.right_wheel.notch_positions, \n",
+ " cat(enigma.lookup(l) for l in string.ascii_lowercase))\n",
+ " enigma.advance()"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Formal test of middle wheel turnover"
]
},
{
"cell_type": "code",
- "execution_count": 356,
+ "execution_count": 179,
"metadata": {
- "collapsed": false
+ "collapsed": true,
+ "scrolled": true
},
"outputs": [],
"source": [
- "wheel_2 = SimpleWheel(wheel_ii_spec)"
+ "enigma.set_wheels('a', 'a', 't')\n",
+ "assert(enigma.wheel_positions == (0, 0, 19))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aat')\n",
+ "assert(enigma.notch_positions == ([10], [22], [24]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'puvioztjdhxmlyeawsrgbcqknf')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 0, 20))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aau')\n",
+ "assert(enigma.notch_positions == ([10], [22], [25]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'baigpldqcowfyzjehvtsxrkumn')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 0, 21))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aav')\n",
+ "assert(enigma.notch_positions == ([10], [22], [0]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'mnvfydiwgzsoablrxpkutchqej')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 1, 22))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'abw')\n",
+ "assert(enigma.notch_positions == ([10], [23], [1]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'ulfopcykswhbzvderqixanjtgm')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 1, 23))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'abx')\n",
+ "assert(enigma.notch_positions == ([10], [23], [2]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'qmwftdyovursbzhxaklejicpgn')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 1, 24))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aby')\n",
+ "assert(enigma.notch_positions == ([10], [23 ], [3]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'oljmzxrvucybdqasngpwihtfke')\n"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "Test of middle wheel advancing the left wheel, exhibiting the \"double step\" behaviour."
]
},
{
"cell_type": "code",
- "execution_count": 357,
+ "execution_count": 180,
"metadata": {
- "collapsed": false
+ "scrolled": true
},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "(1, 5, 24) ('b', 'f', 'y') ([11], [1], [3]) baknstqzrmcxjdvygiefwoulph\n"
+ ]
+ }
+ ],
+ "source": [
+ "enigma.set_wheels('a', 'd', 't')\n",
+ "assert(enigma.wheel_positions == (0, 3, 19))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'adt')\n",
+ "assert(enigma.notch_positions == ([10], [25], [24]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'zcbpqxwsjiuonmldethrkygfva')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 3, 20))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'adu')\n",
+ "assert(enigma.notch_positions == ([10], [25], [25]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'ehprawjbngotxikcsdqlzyfmvu')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 3, 21))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'adv')\n",
+ "assert(enigma.notch_positions == ([10], [25], [0]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'eqzxarpihmnvjkwgbfuyslodtc')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 4, 22))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aew')\n",
+ "assert(enigma.notch_positions == ([10], [0], [1]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'qedcbtpluzmhkongavwfirsyxj')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 23))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfx')\n",
+ "assert(enigma.notch_positions == ([11], [1], [2]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'iwuedhsfazqxytvrkpgncoblmj')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 24))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfy')\n",
+ "assert(enigma.notch_positions == ([11], [1], [3]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'baknstqzrmcxjdvygiefwoulph')\n",
+ "\n",
+ "print(enigma.wheel_positions, enigma.wheel_positions_l, enigma.notch_positions, \n",
+ " cat(enigma.lookup(l) for l in string.ascii_lowercase))\n"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 181,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "('ajdksiruxblhwtmcqgznpyfvoe', 'ajpczwrlfbdkotyuqgenhxmivs')"
+ "'olpfhnvflyn'"
]
},
- "execution_count": 357,
+ "execution_count": 181,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "cat(wheel_2.forward(l) for l in string.ascii_lowercase), cat(wheel_2.backward(l) for l in string.ascii_lowercase)"
+ "enigma.set_wheels('a', 'a', 'a')\n",
+ "ct = enigma.encipher('testmessage')\n",
+ "assert(ct == 'olpfhnvflyn')\n",
+ "ct"
]
},
{
"cell_type": "code",
- "execution_count": 358,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 182,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'cegikboqswuymxdhvfzjltrpna'"
+ "'lawnjgpwjik'"
]
},
- "execution_count": 358,
+ "execution_count": 182,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "wheel_3 = SimpleWheel(wheel_iii_spec)\n",
- "wheel_3.set_position('a')\n",
- "wheel_3.advance()\n",
- "cat(wheel_3.forward(l) for l in string.ascii_lowercase)"
+ "enigma.set_wheels('a', 'd', 't')\n",
+ "ct = enigma.encipher('testmessage')\n",
+ "assert(ct == 'lawnjgpwjik')\n",
+ "ct"
]
},
{
"cell_type": "code",
- "execution_count": 524,
- "metadata": {
- "collapsed": false
- },
- "outputs": [],
+ "execution_count": 183,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 3, 20))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'adu')\n",
+ "assert(enigma.notch_positions == ([10], [25], [25]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'ehprawjbngotxikcsdqlzyfmvu')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 3, 21))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'adv')\n",
+ "assert(enigma.notch_positions == ([10], [25], [0]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'eqzxarpihmnvjkwgbfuyslodtc')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (0, 4, 22))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'aew')\n",
+ "assert(enigma.notch_positions == ([10], [0], [1]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'qedcbtpluzmhkongavwfirsyxj')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 23))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfx')\n",
+ "assert(enigma.notch_positions == ([11], [1], [2]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'iwuedhsfazqxytvrkpgncoblmj')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 24))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfy')\n",
+ "assert(enigma.notch_positions == ([11], [1], [3]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'baknstqzrmcxjdvygiefwoulph')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 25))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfz')\n",
+ "assert(enigma.notch_positions == ([11], [1], [4]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'mudcgteyjiwravxzslqfbnkohp')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 0))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfa')\n",
+ "assert(enigma.notch_positions == ([11], [1], [5]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'gjkuotarmbcziwesvhpfdqnyxl')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 1))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfb')\n",
+ "assert(enigma.notch_positions == ([11], [1], [6]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'fcbmpaqihxytdrvegnwlzosjku')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 2))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfc')\n",
+ "assert(enigma.notch_positions == ([11], [1], [7]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'jktrlpmywabegzqfodxcvuishn')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 3))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfd')\n",
+ "assert(enigma.notch_positions == ([11], [1], [8]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'baetclivgurfzqponkxdjhyswm')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 4))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfe')\n",
+ "assert(enigma.notch_positions == ([11], [1], [9]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'wvjlkpzxtcedqsyfmunirbahog')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 5))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bff')\n",
+ "assert(enigma.notch_positions == ([11], [1], [10]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'zpqiogfsdlmjkyebcvhxwrutna')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 6))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfg')\n",
+ "assert(enigma.notch_positions == ([11], [1], [11]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'fjmnwayslbxicdpouthrqzekgv')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 7))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfh')\n",
+ "assert(enigma.notch_positions == ([11], [1], [12]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'csafzdyloxuhnmitwvbpkrqjge')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 8))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfi')\n",
+ "assert(enigma.notch_positions == ([11], [1], [13]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'kihyvulcbtagwrqzonxjfemsdp')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 9))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfj')\n",
+ "assert(enigma.notch_positions == ([11], [1], [14]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'pgzrytbksqhwxvuajdifonlmec')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 10))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfk')\n",
+ "assert(enigma.notch_positions == ([11], [1], [15]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'fkirsazncwbvyhpoudexqljtmg')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 11))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfl')\n",
+ "assert(enigma.notch_positions == ([11], [1], [16]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'mhkronubsvctafeqpdilgjxwzy')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 12))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfm')\n",
+ "assert(enigma.notch_positions == ([11], [1], [17]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'gnkuoxarzycmlbetvhwpdqsfji')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 13))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfn')\n",
+ "assert(enigma.notch_positions == ([11], [1], [18]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'bainslqkcxhfudpogtermwvjzy')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 14))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfo')\n",
+ "assert(enigma.notch_positions == ([11], [1], [19]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'xemfbdnwjitycgzusvqkprhalo')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 15))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfp')\n",
+ "assert(enigma.notch_positions == ([11], [1], [20]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'qixksmhgbtdvfonrapejwluczy')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 16))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfq')\n",
+ "assert(enigma.notch_positions == ([11], [1], [21]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'cgaulmbskwiefrtzynhodxjvqp')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 17))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfr')\n",
+ "assert(enigma.notch_positions == ([11], [1], [22]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'iwqfldszaxvenmyrcpgutkbjoh')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 18))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bfs')\n",
+ "assert(enigma.notch_positions == ([11], [1], [23]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'vxykrjilgfdhqtusmepnoazbcw')\n",
+ "\n",
+ "enigma.advance()\n",
+ "assert(enigma.wheel_positions == (1, 5, 19))\n",
+ "assert(cat(enigma.wheel_positions_l) == 'bft')\n",
+ "assert(enigma.notch_positions == ([11], [1], [24]))\n",
+ "assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == 'ieysbvkjahgmlpxnwtdrzfqocu')\n",
+ "\n"
+ ]
+ }
+ ],
"source": [
- "class Wheel(SimpleWheel):\n",
- " def __init__(self, transform, ring_peg_letters, ring_setting=1, position='a', raw_transform=False):\n",
- " self.ring_peg_letters = ring_peg_letters\n",
- " self.ring_setting = ring_setting\n",
- " super(Wheel, self).__init__(transform, position=position, raw_transform=raw_transform)\n",
- " self.set_position(position)\n",
- " \n",
- " def set_position(self, position):\n",
- " super(Wheel, self).set_position(position)\n",
- " self.peg_positions = [(ord(p) - ord(position)) % 26 for p in self.ring_peg_letters]\n",
- " self.position = (self.position - self.ring_setting + 1) % 26\n",
- " \n",
- " def advance(self):\n",
- " super(Wheel, self).advance()\n",
- " self.peg_positions = [(p - 1) % 26 for p in self.peg_positions]\n",
- " return self.position"
+ "enigma.set_wheels('a', 'd', 't')\n",
+ "for i in range(26):\n",
+ " enigma.advance()\n",
+ " print('enigma.advance()')\n",
+ " print(\"assert(enigma.wheel_positions == {})\".format(enigma.wheel_positions))\n",
+ " print(\"assert(cat(enigma.wheel_positions_l) == '{}')\".format(cat(enigma.wheel_positions_l)))\n",
+ " print(\"assert(enigma.notch_positions == {})\".format(enigma.notch_positions))\n",
+ " print(\"assert(cat(enigma.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ " print()"
]
},
{
"cell_type": "code",
- "execution_count": 525,
- "metadata": {
- "collapsed": false
- },
- "outputs": [],
+ "execution_count": 184,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "text/plain": [
+ "'bahxvfrpdc'"
+ ]
+ },
+ "execution_count": 184,
+ "metadata": {},
+ "output_type": "execute_result"
+ }
+ ],
"source": [
- "wheel_3 = Wheel(wheel_iii_spec, wheel_iii_pegs, position='b', ring_setting=1)"
+ "enigma.set_wheels('a', 'd', 't')\n",
+ "ct = enigma.encipher('hellothere')\n",
+ "assert(ct == 'bahxvfrpdc')\n",
+ "ct"
]
},
{
"cell_type": "code",
- "execution_count": 526,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 185,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "(1, [20])"
+ "'kvmmwrlqlqsqpeugjrcxzwpfyiyybwloewrouvkpoztceuwtfjzqwpbqldttsr'"
]
},
- "execution_count": 526,
+ "execution_count": 185,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "wheel_3.position, wheel_3.peg_positions"
+ "enigma.set_wheels('b', 'd', 'q')\n",
+ "ct = enigma.encipher('aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa')\n",
+ "assert(ct == 'kvmmwrlqlqsqpeugjrcxzwpfyiyybwloewrouvkpoztceuwtfjzqwpbqldttsr')\n",
+ "assert(enigma.left_wheel.position_l == 'c')\n",
+ "assert(enigma.middle_wheel.position_l == 'h')\n",
+ "assert(enigma.right_wheel.position_l == 'a')\n",
+ "ct"
]
},
{
"cell_type": "code",
- "execution_count": 527,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 186,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "(25, [24, 11])"
+ "'c'"
]
},
- "execution_count": 527,
+ "execution_count": 186,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "wheel_6 = Wheel(wheel_vi_spec, wheel_vi_pegs, position='b', ring_setting=3)\n",
- "wheel_6.position, wheel_6.peg_positions"
+ "enigma.left_wheel.position_l"
]
},
{
"cell_type": "code",
- "execution_count": 528,
+ "execution_count": 187,
"metadata": {
- "collapsed": false,
- "scrolled": true
+ "collapsed": true
},
- "outputs": [
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "0 [23, 10]\n",
- "1 [22, 9]\n",
- "2 [21, 8]\n",
- "3 [20, 7]\n",
- "4 [19, 6]\n",
- "5 [18, 5]\n",
- "6 [17, 4]\n",
- "7 [16, 3]\n",
- "8 [15, 2]\n",
- "9 [14, 1]\n",
- "10 [13, 0]\n",
- "11 [12, 25]\n",
- "12 [11, 24]\n",
- "13 [10, 23]\n",
- "14 [9, 22]\n",
- "15 [8, 21]\n",
- "16 [7, 20]\n",
- "17 [6, 19]\n",
- "18 [5, 18]\n",
- "19 [4, 17]\n",
- "20 [3, 16]\n",
- "21 [2, 15]\n",
- "22 [1, 14]\n",
- "23 [0, 13]\n",
- "24 [25, 12]\n",
- "25 [24, 11]\n",
- "0 [23, 10]\n"
- ]
- }
- ],
+ "outputs": [],
"source": [
- "for _ in range(27):\n",
- " wheel_6.advance()\n",
- " print(wheel_6.position, wheel_6.peg_positions)"
+ "# Setting sheet line 31 from http://www.codesandciphers.org.uk/enigma/enigma3.htm\n",
+ "# Enigma simulation settings are \n",
+ "# http://enigma.louisedade.co.uk/enigma.html?m3;b;b153;AFTX;AJFE;AU-BG-EY-FP-HL-IN-JZ-OS-QR-TX\n",
+ "w_enigma = Enigma(reflector_b_spec, \n",
+ " wheel_i_spec, wheel_i_notches,\n",
+ " wheel_v_spec, wheel_v_notches,\n",
+ " wheel_iii_spec, wheel_iii_notches,\n",
+ " 6, 20, 24,\n",
+ " 'ua pf rq so ni ey bg hl tx zj')"
]
},
{
"cell_type": "code",
- "execution_count": 529,
+ "execution_count": 188,
"metadata": {
"collapsed": true
},
"outputs": [],
- "source": [
- "class Enigma(object):\n",
- " def __init__(self, reflector_spec,\n",
- " left_wheel_spec, left_wheel_pegs,\n",
- " middle_wheel_spec, middle_wheel_pegs,\n",
- " right_wheel_spec, right_wheel_pegs,\n",
- " left_ring_setting, middle_ring_setting, right_ring_setting,\n",
- " plugboard_setting):\n",
- " self.reflector = Reflector(reflector_spec)\n",
- " self.left_wheel = Wheel(left_wheel_spec, left_wheel_pegs, ring_setting=left_ring_setting)\n",
- " self.middle_wheel = Wheel(middle_wheel_spec, middle_wheel_pegs, ring_setting=middle_ring_setting)\n",
- " self.right_wheel = Wheel(right_wheel_spec, right_wheel_pegs, ring_setting=right_ring_setting)\n",
- " self.plugboard = Plugboard(plugboard_setting)\n",
- " \n",
- " def set_wheels(self, left_wheel_position, middle_wheel_position, right_wheel_position):\n",
- " self.left_wheel.set_position(left_wheel_position)\n",
- " self.middle_wheel.set_position(middle_wheel_position)\n",
- " self.right_wheel.set_position(right_wheel_position)\n",
- " \n",
- " def lookup(self, letter):\n",
- " a = self.plugboard.forward(letter)\n",
- " b = self.right_wheel.forward(a)\n",
- " c = self.middle_wheel.forward(b)\n",
- " d = self.left_wheel.forward(c)\n",
- " e = self.reflector.forward(d)\n",
- " f = self.left_wheel.backward(e)\n",
- " g = self.middle_wheel.backward(f)\n",
- " h = self.right_wheel.backward(g)\n",
- " i = self.plugboard.backward(h)\n",
- " return i\n",
- " \n",
- " def advance(self):\n",
- " advance_middle = False\n",
- " advance_left = False\n",
- " if 0 in self.right_wheel.peg_positions:\n",
- " advance_middle = True\n",
- " if 0 in self.middle_wheel.peg_positions:\n",
- " advance_left = True\n",
- " if 0 in self.middle_wheel.peg_positions and 25 in self.right_wheel.peg_positions:\n",
- " advance_middle = True\n",
- " advance_left = True\n",
- " self.right_wheel.advance()\n",
- " if advance_middle: self.middle_wheel.advance()\n",
- " if advance_left: self.left_wheel.advance()\n",
- " \n",
- " def encipher_letter(self, letter):\n",
- " self.advance()\n",
- " return self.lookup(letter)\n",
- " \n",
- " def encipher(self, message):\n",
- " enciphered = ''\n",
- " for letter in message:\n",
- " enciphered += self.encipher_letter(letter)\n",
- " return enciphered"
+ "source": [
+ "# # Setting sheet line 31 from http://www.codesandciphers.org.uk/enigma/enigma3.htm\n",
+ "# # Enigma simulation settings are \n",
+ "# # http://enigma.louisedade.co.uk/enigma.html?m3;b;b153;AFTX;AJFE;AU-BG-EY-FP-HL-IN-JZ-OS-QR-TX\n",
+ "# enigma = Enigma(reflector_b_spec, \n",
+ "# wheel_i_spec, wheel_i_notches,\n",
+ "# wheel_v_spec, wheel_v_notches,\n",
+ "# wheel_iii_spec, wheel_iii_notches,\n",
+ "# 6, 20, 24,\n",
+ "# 'ua pf rq so ni ey bg hl tx zj')"
]
},
{
"cell_type": "code",
- "execution_count": 548,
+ "execution_count": 189,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
"outputs": [],
"source": [
- "enigma = Enigma(reflector_b_spec, \n",
- " wheel_i_spec, wheel_i_pegs,\n",
- " wheel_ii_spec, wheel_ii_pegs,\n",
- " wheel_iii_spec, wheel_iii_pegs,\n",
- " 1, 1, 1,\n",
- " '')"
+ "w_enigma.set_wheels('j', 'e', 'u')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (4, 11, 24))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jev')\n",
+ "assert(w_enigma.notch_positions == ([19], [5], [0]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'mvqjlyowkdieasgzcunxrbhtfp')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (4, 12, 25))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jfw')\n",
+ "assert(w_enigma.notch_positions == ([19], [6], [1]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'sjolzuyvrbwdpxcmtiaqfhknge')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (4, 12, 0))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jfx')\n",
+ "assert(w_enigma.notch_positions == ([19], [6], [2]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'qrxedkoywufmlvgsabpzjnicht')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (4, 12, 1))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jfy')\n",
+ "assert(w_enigma.notch_positions == ([19], [6], [3]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'hpsukliagqefwvtbjxcodnmrzy')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (4, 12, 2))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jfz')\n",
+ "assert(w_enigma.notch_positions == ([19], [6], [4]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'zevnbpyqowrtxdifhkulscjmga')\n"
]
},
{
"cell_type": "code",
- "execution_count": 549,
+ "execution_count": 190,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
+ "outputs": [],
+ "source": [
+ "w_enigma.set_wheels('i', 'd', 'z')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 3))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ida')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [5]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'ikhpqrvcambzjondefwyxgsutl')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 4))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idb')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [6]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'cdabskhgzwfmlqvunyexpojtri')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 5))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idc')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [7]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'pcbwiqhgemyvjsuaftnroldzkx')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 6))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idd')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [8]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'xcbfvdnouptmlghjzwykierasq')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 7))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ide')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [9]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'xfvglbdynuseriwqpmkzjcoaht')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 8))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idf')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [10]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'tfpqlbouynsewjgcdxkahzmriv')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 9))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idg')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [11]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'cjaunvlwtbygzexrspqidfhokm')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 10))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idh')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [12]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'yltxkrqvowebzpingfucshjdam')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 11))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idi')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [13]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'myktluzrnxceaiqsohpdfwvjbg')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 12))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idj')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [14]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'pynjrmiugdqxfcvakewzhoslbt')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 13))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idk')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [15]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'mwvedyplnoxhaijgrqtszcbkfu')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 14))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idl')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [16]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'qcbrfeutvoxpnmjladzhgiykws')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 15))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idm')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [17]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'dnoahryetsmukbcvwfjilpqzgx')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 16))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idn')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [18]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'nidcfehgbqsovalyjzkxwmutpr')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 17))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ido')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [19]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'joifxdulcarhzpbntkwqgysevm')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 18))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idp')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [20]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'ptnlsxvozmwdjchayuebrgkfqi')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 19))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idq')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [21]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'slwopzqnmxybihdeguavrtcjkf')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 20))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idr')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [22]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'hcbedwlamzogixkytsrqvufnpj')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 21))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ids')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [23]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'odxbjwzrmelkisavuhnyqpfctg')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 22))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idt')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [24]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'udgbfeclrwnhxksvtioqapjmzy')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 23))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idu')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [25]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'nrdczqxmowvshaiufblypkjgte')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 24))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idv')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [0]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'hkifjdoacebqtzgulyvmpsxwrn')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 25))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iew')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [1]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'yptzuhofqvnmlkgbixwcejsrad')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 0))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iex')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [2]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'vkdcwhqfjibzsptngumoraeyxl')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 1))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iey')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [3]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'wenpbqrouxlkychdfgzvitajms')\n"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 191,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'u'"
+ "([18], [5], [3])"
]
},
- "execution_count": 549,
+ "execution_count": 191,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.lookup('a')"
+ "w_enigma.notch_positions"
]
},
{
"cell_type": "code",
- "execution_count": 550,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 192,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'a'"
+ "('verylongtestmessagewithanextrabitofmessageforgoodmeasure',\n",
+ " (3, 12, 6),\n",
+ " ('i', 'f', 'd'),\n",
+ " ([18], [6], [8]),\n",
+ " 'urygzpdmxtwshqvfnbljaokice')"
]
},
- "execution_count": 550,
+ "execution_count": 192,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.lookup('u')"
+ "w_enigma.set_wheels('i', 'd', 'z')\n",
+ "ct = w_enigma.encipher('verylongtestmessagewithanextrabitofmessageforgoodmeasure')\n",
+ "assert(ct == 'gstsegeqdrthkfwesljjomfvcqwcfspxpfqqmewvddybarzwubxtpejz')\n",
+ "assert(w_enigma.wheel_positions == (3, 12, 6))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ifd')\n",
+ "assert(w_enigma.notch_positions == ([18], [6], [8]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'urygzpdmxtwshqvfnbljaokice')\n",
+ "\n",
+ "w_enigma.set_wheels('i', 'd', 'z')\n",
+ "pt = w_enigma.encipher('gstsegeqdrthkfwesljjomfvcqwcfspxpfqqmewvddybarzwubxtpejz')\n",
+ "assert(pt == 'verylongtestmessagewithanextrabitofmessageforgoodmeasure')\n",
+ "\n",
+ "pt, w_enigma.wheel_positions, w_enigma.wheel_positions_l, w_enigma.notch_positions, cat(w_enigma.lookup(l) for l in string.ascii_lowercase)"
]
},
{
"cell_type": "code",
- "execution_count": 551,
- "metadata": {
- "collapsed": false,
- "scrolled": true
- },
+ "execution_count": 193,
+ "metadata": {},
"outputs": [
{
"name": "stdout",
"output_type": "stream",
"text": [
- "a a a ; [16] [4] [21]\n",
- "a a b ; [16] [4] [20]\n",
- "a a c ; [16] [4] [19]\n",
- "a a d ; [16] [4] [18]\n",
- "a a e ; [16] [4] [17]\n",
- "a a f ; [16] [4] [16]\n",
- "a a g ; [16] [4] [15]\n",
- "a a h ; [16] [4] [14]\n",
- "a a i ; [16] [4] [13]\n",
- "a a j ; [16] [4] [12]\n",
- "a a k ; [16] [4] [11]\n",
- "a a l ; [16] [4] [10]\n",
- "a a m ; [16] [4] [9]\n",
- "a a n ; [16] [4] [8]\n",
- "a a o ; [16] [4] [7]\n",
- "a a p ; [16] [4] [6]\n",
- "a a q ; [16] [4] [5]\n",
- "a a r ; [16] [4] [4]\n",
- "a a s ; [16] [4] [3]\n",
- "a a t ; [16] [4] [2]\n",
- "a a u ; [16] [4] [1]\n",
- "a a v ; [16] [4] [0]\n",
- "a b w ; [16] [3] [25]\n",
- "a b x ; [16] [3] [24]\n",
- "a b y ; [16] [3] [23]\n",
- "a b z ; [16] [3] [22]\n"
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 3))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ida')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [5]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'ikhpqrvcambzjondefwyxgsutl')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 4))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idb')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [6]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'cdabskhgzwfmlqvunyexpojtri')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 5))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idc')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [7]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'pcbwiqhgemyvjsuaftnroldzkx')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 6))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idd')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [8]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'xcbfvdnouptmlghjzwykierasq')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 7))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ide')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [9]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'xfvglbdynuseriwqpmkzjcoaht')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 8))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idf')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [10]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'tfpqlbouynsewjgcdxkahzmriv')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 9))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idg')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [11]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'cjaunvlwtbygzexrspqidfhokm')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 10))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idh')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [12]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'yltxkrqvowebzpingfucshjdam')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 11))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idi')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [13]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'myktluzrnxceaiqsohpdfwvjbg')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 12))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idj')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [14]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'pynjrmiugdqxfcvakewzhoslbt')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 13))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idk')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [15]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'mwvedyplnoxhaijgrqtszcbkfu')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 14))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idl')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [16]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'qcbrfeutvoxpnmjladzhgiykws')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 15))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idm')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [17]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'dnoahryetsmukbcvwfjilpqzgx')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 16))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idn')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [18]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'nidcfehgbqsovalyjzkxwmutpr')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 17))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ido')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [19]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'joifxdulcarhzpbntkwqgysevm')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 18))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idp')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [20]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'ptnlsxvozmwdjchayuebrgkfqi')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 19))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idq')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [21]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'slwopzqnmxybihdeguavrtcjkf')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 20))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idr')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [22]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'hcbedwlamzogixkytsrqvufnpj')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 21))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'ids')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [23]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'odxbjwzrmelkisavuhnyqpfctg')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 22))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idt')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [24]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'udgbfeclrwnhxksvtioqapjmzy')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 23))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idu')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [25]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'nrdczqxmowvshaiufblypkjgte')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 10, 24))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'idv')\n",
+ "assert(w_enigma.notch_positions == ([18], [4], [0]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'hkifjdoacebqtzgulyvmpsxwrn')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 25))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iew')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [1]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'yptzuhofqvnmlkgbixwcejsrad')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 0))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iex')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [2]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'vkdcwhqfjibzsptngumoraeyxl')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 1))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iey')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [3]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'wenpbqrouxlkychdfgzvitajms')\n",
+ "\n",
+ "w_enigma.advance()\n",
+ "assert(w_enigma.wheel_positions == (3, 11, 2))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'iez')\n",
+ "assert(w_enigma.notch_positions == ([18], [5], [4]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'szgyqvclkoihurjwenaxmfptdb')\n",
+ "\n"
]
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "for _ in range(26):\n",
- " print(enigma.left_wheel.position_l, enigma.middle_wheel.position_l, enigma.right_wheel.position_l, ';',\n",
- " enigma.left_wheel.peg_positions, enigma.middle_wheel.peg_positions, enigma.right_wheel.peg_positions)\n",
- " enigma.advance()"
+ "w_enigma.set_wheels('i', 'd', 'z')\n",
+ "\n",
+ "for i in range(26):\n",
+ " w_enigma.advance()\n",
+ " print('w_enigma.advance()')\n",
+ " print(\"assert(w_enigma.wheel_positions == {})\".format(w_enigma.wheel_positions))\n",
+ " print(\"assert(cat(w_enigma.wheel_positions_l) == '{}')\".format(cat(w_enigma.wheel_positions_l)))\n",
+ " print(\"assert(w_enigma.notch_positions == {})\".format(w_enigma.notch_positions))\n",
+ " print(\"assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(w_enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ " print()"
]
},
{
"cell_type": "code",
- "execution_count": 552,
- "metadata": {
- "collapsed": false,
- "scrolled": true
- },
+ "execution_count": 215,
+ "metadata": {},
"outputs": [
{
"name": "stdout",
"output_type": "stream",
"text": [
- "a d t ; [16] [1] [2]\n",
- "a d u ; [16] [1] [1]\n",
- "a d v ; [16] [1] [0]\n",
- "a e w ; [16] [0] [25]\n",
- "b f x ; [15] [25] [24]\n",
- "b f y ; [15] [25] [23]\n",
- "b f z ; [15] [25] [22]\n",
- "b f a ; [15] [25] [21]\n",
- "b f b ; [15] [25] [20]\n",
- "b f c ; [15] [25] [19]\n",
- "b f d ; [15] [25] [18]\n",
- "b f e ; [15] [25] [17]\n",
- "b f f ; [15] [25] [16]\n",
- "b f g ; [15] [25] [15]\n",
- "b f h ; [15] [25] [14]\n",
- "b f i ; [15] [25] [13]\n",
- "b f j ; [15] [25] [12]\n",
- "b f k ; [15] [25] [11]\n",
- "b f l ; [15] [25] [10]\n",
- "b f m ; [15] [25] [9]\n",
- "b f n ; [15] [25] [8]\n",
- "b f o ; [15] [25] [7]\n",
- "b f p ; [15] [25] [6]\n",
- "b f q ; [15] [25] [5]\n",
- "b f r ; [15] [25] [4]\n",
- "b f s ; [15] [25] [3]\n"
+ "self.assertEqual(self.enigma31.wheel_positions, (21, 5, 22))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'ayt')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([10], [25], [24]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'izhrgtecaslkywvqpdjfxonumb')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (21, 5, 23))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'ayu')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([10], [25], [25]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'dtoavihgflwjnmcsrqpbzekyxu')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (21, 5, 24))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'ayv')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([10], [25], [0]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'xquhtpsdwkjonmlfbvgecriazy')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (21, 6, 25))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'azw')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([10], [0], [1]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'dofapcluvmngjkbezyxwhitsrq')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 7, 0))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bax')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [1], [2]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'jdlbmswztapcexrkuofiqygnvh')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 7, 1))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bay')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [1], [3]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'iydcnuhgawsoxelztvkqfrjmbp')\n",
+ "\n"
]
}
],
"source": [
- "enigma.set_wheels('a', 'd', 't')\n",
- "for _ in range(26):\n",
- " print(enigma.left_wheel.position_l, enigma.middle_wheel.position_l, enigma.right_wheel.position_l, ';',\n",
- " enigma.left_wheel.peg_positions, enigma.middle_wheel.peg_positions, enigma.right_wheel.peg_positions)\n",
- " enigma.advance()"
+ "w_enigma.set_wheels('a', 'y', 't')\n",
+ "\n",
+ "print(\"self.assertEqual(self.enigma31.wheel_positions, {})\".format(w_enigma.wheel_positions))\n",
+ "print(\"self.assertEqual(cat(self.enigma31.wheel_positions_l), '{}')\".format(cat(w_enigma.wheel_positions_l)))\n",
+ "print(\"self.assertEqual(self.enigma31.notch_positions, {})\".format(w_enigma.notch_positions))\n",
+ "print(\"assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(w_enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ "print()\n",
+ "\n",
+ "for i in range(5):\n",
+ " w_enigma.advance()\n",
+ " print('self.enigma31.advance()')\n",
+ " print(\"self.assertEqual(self.enigma31.wheel_positions, {})\".format(w_enigma.wheel_positions))\n",
+ " print(\"self.assertEqual(cat(self.enigma31.wheel_positions_l), '{}')\".format(cat(w_enigma.wheel_positions_l)))\n",
+ " print(\"self.assertEqual(self.enigma31.notch_positions, {})\".format(w_enigma.notch_positions))\n",
+ " print(\"assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(w_enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ " print()"
]
},
{
"cell_type": "code",
- "execution_count": 553,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 216,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "self.assertEqual(self.enigma31.wheel_positions, (21, 6, 22))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'azt')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([10], [0], [24]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'idjbptqwacsvnmregokfzlhyxu')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 7, 23))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bau')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [1], [25]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'rniszouwcxtvqbfymadkglhjpe')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 7, 24))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bav')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [1], [0]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'qijfsdmkbchugxtwazeolypnvr')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 8, 25))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bbw')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [2], [1]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'xprtlozyskjewqfbncidvumahg')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 8, 0))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bbx')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [2], [2]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'vtfuyczoqxmpkwhlisrbdanjeg')\n",
+ "\n",
+ "self.enigma31.advance()\n",
+ "self.assertEqual(self.enigma31.wheel_positions, (22, 8, 1))\n",
+ "self.assertEqual(cat(self.enigma31.wheel_positions_l), 'bby')\n",
+ "self.assertEqual(self.enigma31.notch_positions, ([11], [2], [3]))\n",
+ "assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == 'tjrhzpqdobwxyuifgcvansklme')\n",
+ "\n"
+ ]
+ }
+ ],
+ "source": [
+ "w_enigma.set_wheels('a', 'z', 't')\n",
+ "\n",
+ "print(\"self.assertEqual(self.enigma31.wheel_positions, {})\".format(w_enigma.wheel_positions))\n",
+ "print(\"self.assertEqual(cat(self.enigma31.wheel_positions_l), '{}')\".format(cat(w_enigma.wheel_positions_l)))\n",
+ "print(\"self.assertEqual(self.enigma31.notch_positions, {})\".format(w_enigma.notch_positions))\n",
+ "print(\"assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(w_enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ "print()\n",
+ "\n",
+ "for i in range(5):\n",
+ " w_enigma.advance()\n",
+ " print('self.enigma31.advance()')\n",
+ " print(\"self.assertEqual(self.enigma31.wheel_positions, {})\".format(w_enigma.wheel_positions))\n",
+ " print(\"self.assertEqual(cat(self.enigma31.wheel_positions_l), '{}')\".format(cat(w_enigma.wheel_positions_l)))\n",
+ " print(\"self.assertEqual(self.enigma31.notch_positions, {})\".format(w_enigma.notch_positions))\n",
+ " print(\"assert(cat(self.enigma31.lookup(l) for l in string.ascii_lowercase) == '{}')\".format(cat(w_enigma.lookup(l) for l in string.ascii_lowercase)))\n",
+ " print()"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 221,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "w_enigma.set_wheels('i', 'z', 'd')\n",
+ "ct = w_enigma.encipher('verylongtestmessagewithanextrabitofmessageforgoodmeasure')\n",
+ "assert(ct == 'apocwtjuikurcfivlozvhffkoacxufcekthcvodfqpxdjqyckdozlqki')\n",
+ "assert(w_enigma.wheel_positions == (4, 9, 10))\n",
+ "assert(cat(w_enigma.wheel_positions_l) == 'jch')\n",
+ "assert(w_enigma.notch_positions == ([19], [3], [12]))\n",
+ "assert(cat(w_enigma.lookup(l) for l in string.ascii_lowercase) == 'mopnigfuesqwadbcktjrhylzvx')\n",
+ "\n",
+ "w_enigma.set_wheels('i', 'z', 'd')\n",
+ "pt = w_enigma.decipher('apocwtjuikurcfivlozvhffkoacxufcekthcvodfqpxdjqyckdozlqki')\n",
+ "assert(pt == 'verylongtestmessagewithanextrabitofmessageforgoodmeasure')"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 218,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'i'"
+ "([19], [3], [12])"
]
},
- "execution_count": 553,
+ "execution_count": 218,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "enigma.advance()\n",
- "enigma.lookup('h')"
+ "w_enigma.notch_positions"
]
},
{
"cell_type": "code",
- "execution_count": 560,
+ "execution_count": 194,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
+ "outputs": [],
+ "source": [
+ "# Reflector B\n",
+ "# Rotors III, I, II with rings 17, 11, 19\n",
+ "# Plugboard pairs GU FZ BD LK TC PS HV WN JE AM\n",
+ "\n",
+ "tbt_enigma = Enigma(reflector_b_spec, \n",
+ " wheel_iii_spec, wheel_iii_notches,\n",
+ " wheel_i_spec, wheel_i_notches,\n",
+ " wheel_ii_spec, wheel_ii_notches,\n",
+ " 17, 11, 19,\n",
+ " 'GU FZ BD LK TC PS HV WN JE AM'.lower())"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 195,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'ilbdartydc'"
+ "'jbvbwwzfslhxnhzzccsngebmrnswgjonwbjnzcfgadeuoyameylmpvny'"
]
},
- "execution_count": 560,
+ "execution_count": 195,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "ct = enigma.encipher('hellothere')\n",
- "assert(ct == 'ilbdartydc')\n",
+ "tbt_enigma.set_wheels('a', 'q', 'v')\n",
+ "ct = tbt_enigma.encipher('very long test message with an extra bit of message for good measure')\n",
"ct"
]
},
{
"cell_type": "code",
- "execution_count": 555,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 196,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'hellothere'"
+ "'SLGNC SZXLT KZEBG HSTGY WDMPR'"
]
},
- "execution_count": 555,
+ "execution_count": 196,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "pt = enigma.encipher(ct)\n",
- "pt"
+ "target_ct = 'SLGNC SZXLT KZEBG HSTGY WDMPR'\n",
+ "target_ct"
]
},
{
"cell_type": "code",
- "execution_count": 556,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 197,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'i'"
+ "'Theyw erede tecte d byBri tishs hipsi nclud'"
]
},
- "execution_count": 556,
+ "execution_count": 197,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "enigma.advance()\n",
- "enigma.lookup('h')"
+ "target_pt = 'Theyw erede tecte d byBri tishs hipsi nclud'\n",
+ "target_pt"
]
},
{
"cell_type": "code",
- "execution_count": 557,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 198,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "('h', 'q', 'q', 'x', 'j', 'z', 's', 'i', 'i')"
+ "(29, 43)"
]
},
- "execution_count": 557,
+ "execution_count": 198,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'a', 'a')\n",
- "enigma.advance()\n",
- "a = enigma.plugboard.forward('h')\n",
- "b = enigma.right_wheel.forward(a)\n",
- "c = enigma.middle_wheel.forward(b)\n",
- "d = enigma.left_wheel.forward(c)\n",
- "e = enigma.reflector.forward(d)\n",
- "f = enigma.left_wheel.backward(e)\n",
- "g = enigma.middle_wheel.backward(f)\n",
- "h = enigma.right_wheel.backward(g)\n",
- "i = enigma.plugboard.backward(h)\n",
- "a, b, c, d, e, f, g, h, i"
+ "len(target_ct), len(target_pt)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 199,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "SLGNC SZXLT KZEBG HSTGY WDMPR\n",
+ "Theyw erede tecte d byBri tishs hipsi nclud\n"
+ ]
+ }
+ ],
+ "source": [
+ "print('{}\\n{}'.format(target_ct, target_pt))"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 200,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "Theyw erede tecte d byBri tishs hipsi nclud\n",
+ "SLGNC SZXLT KZEBG HSTGY WDMPR\n",
+ "slgncszxltkzebghstgywdmprucuzqdqzpve\n",
+ "theyweredetectedbybritish\n"
+ ]
+ }
+ ],
+ "source": [
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "this_pt = tbt_enigma.encipher(target_ct)\n",
+ "\n",
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "this_ct = tbt_enigma.encipher(target_pt)\n",
+ "\n",
+ "\n",
+ "print('{}\\n{}\\n{}\\n{}'.format(target_pt, target_ct, this_ct, this_pt))"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 201,
+ "metadata": {
+ "collapsed": true
+ },
+ "outputs": [],
+ "source": [
+ "import itertools"
]
},
{
"cell_type": "code",
- "execution_count": 558,
+ "execution_count": 202,
"metadata": {
- "collapsed": false
+ "collapsed": true
},
+ "outputs": [],
+ "source": [
+ "def str_ham(s1, s2):\n",
+ " \"\"\"Hamming distance for strings\"\"\"\n",
+ " return sum(1 for c1, c2 in zip(s1, s2) if c1 != c2)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 203,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'h'"
+ "0"
]
},
- "execution_count": 558,
+ "execution_count": 203,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "pb = Plugboard('')\n",
- "pb.forward('h')"
+ "str_ham('hello', 'hello')"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "A brute-force check of all message settings, looking for the one that generates the target text."
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 204,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "best ('a', 'a', 'a') 29\n",
+ "best ('a', 'a', 'a') 29\n",
+ "best ('a', 'a', 'a') 29\n",
+ "best ('a', 'a', 'a') 29\n",
+ "1 loop, best of 3: 20.6 s per loop\n"
+ ]
+ }
+ ],
+ "source": [
+ "%%timeit\n",
+ "best = ('a', 'a', 'a')\n",
+ "best_hd = 10000\n",
+ "for w1, w2, w3 in itertools.product(string.ascii_lowercase, repeat=3):\n",
+ " tbt_enigma.set_wheels(w1, w2, w3)\n",
+ " this_ct = tbt_enigma.encipher(target_pt)\n",
+ " if this_ct == target_ct:\n",
+ " print(w1, w2, w3)\n",
+ " if str_ham(this_ct, target_ct) < best_hd:\n",
+ " best = (w1, w2, w3)\n",
+ " best_hd = str_ham(this_ct, target_ct)\n",
+ "print('best', best, best_hd)"
]
},
{
"cell_type": "code",
- "execution_count": 561,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 205,
+ "metadata": {},
"outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "Wheels now ['a', 'a', 'b'] enciphering t -> s\n",
+ "Wheels now ['a', 'a', 'c'] enciphering h -> l\n",
+ "Wheels now ['a', 'a', 'd'] enciphering e -> g\n",
+ "Wheels now ['a', 'a', 'e'] enciphering y -> n\n",
+ "Wheels now ['a', 'b', 'f'] enciphering w -> c\n",
+ "Wheels now ['a', 'b', 'g'] enciphering e -> s\n",
+ "Wheels now ['a', 'b', 'h'] enciphering r -> z\n",
+ "Wheels now ['a', 'b', 'i'] enciphering e -> x\n",
+ "Wheels now ['a', 'b', 'j'] enciphering d -> l\n",
+ "Wheels now ['a', 'b', 'k'] enciphering e -> t\n",
+ "Wheels now ['a', 'b', 'l'] enciphering t -> k\n",
+ "Wheels now ['a', 'b', 'm'] enciphering e -> z\n",
+ "Wheels now ['a', 'b', 'n'] enciphering c -> e\n",
+ "Wheels now ['a', 'b', 'o'] enciphering t -> b\n",
+ "Wheels now ['a', 'b', 'p'] enciphering e -> g\n",
+ "Wheels now ['a', 'b', 'q'] enciphering d -> h\n",
+ "Wheels now ['a', 'b', 'r'] enciphering b -> s\n",
+ "Wheels now ['a', 'b', 's'] enciphering y -> t\n",
+ "Wheels now ['a', 'b', 't'] enciphering b -> g\n",
+ "Wheels now ['a', 'b', 'u'] enciphering r -> y\n",
+ "Wheels now ['a', 'b', 'v'] enciphering i -> w\n",
+ "Wheels now ['a', 'b', 'w'] enciphering t -> d\n",
+ "Wheels now ['a', 'b', 'x'] enciphering i -> m\n",
+ "Wheels now ['a', 'b', 'y'] enciphering s -> p\n",
+ "Wheels now ['a', 'b', 'z'] enciphering h -> r\n",
+ "Wheels now ['a', 'b', 'a'] enciphering s -> u\n",
+ "Wheels now ['a', 'b', 'b'] enciphering h -> c\n",
+ "Wheels now ['a', 'b', 'c'] enciphering i -> u\n",
+ "Wheels now ['a', 'b', 'd'] enciphering p -> z\n",
+ "Wheels now ['a', 'b', 'e'] enciphering s -> q\n",
+ "Wheels now ['a', 'c', 'f'] enciphering i -> d\n",
+ "Wheels now ['a', 'c', 'g'] enciphering n -> q\n",
+ "Wheels now ['a', 'c', 'h'] enciphering c -> z\n",
+ "Wheels now ['a', 'c', 'i'] enciphering l -> p\n",
+ "Wheels now ['a', 'c', 'j'] enciphering u -> v\n",
+ "Wheels now ['a', 'c', 'k'] enciphering d -> e\n"
+ ]
+ },
{
"data": {
"text/plain": [
- "'bahxvfrpdc'"
+ "('slgncszxltkzebghstgywdmprucuzqdqzpve', 'SLGNC SZXLT KZEBG HSTGY WDMPR')"
]
},
- "execution_count": 561,
+ "execution_count": 205,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('a', 'd', 't')\n",
- "ct = enigma.encipher('hellothere')\n",
- "assert(ct == 'bahxvfrpdc')\n",
- "ct"
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "tbt_enigma.encipher(target_pt, debug=True), target_ct"
]
},
{
"cell_type": "code",
- "execution_count": 562,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 206,
+ "metadata": {},
"outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "Wheels now ['a', 'a', 'b'] enciphering s -> t\n",
+ "Wheels now ['a', 'a', 'c'] enciphering l -> h\n",
+ "Wheels now ['a', 'a', 'd'] enciphering g -> e\n",
+ "Wheels now ['a', 'a', 'e'] enciphering n -> y\n",
+ "Wheels now ['a', 'b', 'f'] enciphering c -> w\n",
+ "Wheels now ['a', 'b', 'g'] enciphering s -> e\n",
+ "Wheels now ['a', 'b', 'h'] enciphering z -> r\n",
+ "Wheels now ['a', 'b', 'i'] enciphering x -> e\n",
+ "Wheels now ['a', 'b', 'j'] enciphering l -> d\n",
+ "Wheels now ['a', 'b', 'k'] enciphering t -> e\n",
+ "Wheels now ['a', 'b', 'l'] enciphering k -> t\n",
+ "Wheels now ['a', 'b', 'm'] enciphering z -> e\n",
+ "Wheels now ['a', 'b', 'n'] enciphering e -> c\n",
+ "Wheels now ['a', 'b', 'o'] enciphering b -> t\n",
+ "Wheels now ['a', 'b', 'p'] enciphering g -> e\n",
+ "Wheels now ['a', 'b', 'q'] enciphering h -> d\n",
+ "Wheels now ['a', 'b', 'r'] enciphering s -> b\n",
+ "Wheels now ['a', 'b', 's'] enciphering t -> y\n",
+ "Wheels now ['a', 'b', 't'] enciphering g -> b\n",
+ "Wheels now ['a', 'b', 'u'] enciphering y -> r\n",
+ "Wheels now ['a', 'b', 'v'] enciphering w -> i\n",
+ "Wheels now ['a', 'b', 'w'] enciphering d -> t\n",
+ "Wheels now ['a', 'b', 'x'] enciphering m -> i\n",
+ "Wheels now ['a', 'b', 'y'] enciphering p -> s\n",
+ "Wheels now ['a', 'b', 'z'] enciphering r -> h\n"
+ ]
+ },
{
"data": {
"text/plain": [
- "'kvmmwrlqlqsqpeugjrcxzwpfyiyybwloewrouvkpoztceuwtfjzqwpbqldttsr'"
+ "('theyweredetectedbybritish', 'Theyw erede tecte d byBri tishs hipsi nclud')"
]
},
- "execution_count": 562,
+ "execution_count": 206,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.set_wheels('b', 'd', 'q')\n",
- "ct = enigma.encipher('aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa')\n",
- "assert(ct == 'kvmmwrlqlqsqpeugjrcxzwpfyiyybwloewrouvkpoztceuwtfjzqwpbqldttsr')\n",
- "assert(enigma.left_wheel.position_l == 'c')\n",
- "assert(enigma.middle_wheel.position_l == 'h')\n",
- "assert(enigma.right_wheel.position_l == 'a')\n",
- "ct"
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "tbt_enigma.encipher(target_ct, debug=True), target_pt"
]
},
{
"cell_type": "code",
- "execution_count": 563,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 207,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'c'"
+ "('theyweredetectedbybritish', 'Theyw erede tecte d byBri tishs hipsi nclud')"
]
},
- "execution_count": 563,
+ "execution_count": 207,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "enigma.left_wheel.position_l"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 564,
- "metadata": {
- "collapsed": true
- },
- "outputs": [],
- "source": [
- "# Setting sheet line 31 from http://www.codesandciphers.org.uk/enigma/enigma3.htm\n",
- "# Enigma simulation settings are \n",
- "# http://enigma.louisedade.co.uk/enigma.html?m3;b;b153;AFTX;AJFE;AU-BG-EY-FP-HL-IN-JZ-OS-QR-TX\n",
- "w_enigma = Enigma(reflector_b_spec, \n",
- " wheel_i_spec, wheel_i_pegs,\n",
- " wheel_v_spec, wheel_v_pegs,\n",
- " wheel_iii_spec, wheel_iii_pegs,\n",
- " 6, 20, 24,\n",
- " 'ua pf rq so ni ey bg hl tx zj')"
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "tbt_enigma.encipher(target_ct), target_pt"
]
},
{
"cell_type": "code",
- "execution_count": 566,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 208,
+ "metadata": {},
"outputs": [
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "wzmfiwuntn\n"
- ]
- },
{
"data": {
"text/plain": [
- "'wzmfiwuntn'"
+ "'mdtbjzuvielkawosqrpcghnxyf'"
]
},
- "execution_count": 566,
+ "execution_count": 208,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "w_enigma.set_wheels('j', 'e', 'u')\n",
- "ct = w_enigma.encipher('hellothere')\n",
- "print(ct)\n",
- "assert(ct == 'wzmfiwuntn')\n",
- "ct"
+ "cat(tbt_enigma.plugboard.forward(l) for l in string.ascii_lowercase)"
]
},
{
"cell_type": "code",
- "execution_count": 568,
- "metadata": {
- "collapsed": false
- },
+ "execution_count": 209,
+ "metadata": {},
"outputs": [
{
"data": {
"text/plain": [
- "'ayraqvsfkhflwsmkqicvfwawswmiwvvlteb'"
+ "10"
]
},
- "execution_count": 568,
+ "execution_count": 209,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
- "w_enigma.set_wheels('n', 'y', 'q')\n",
- "ct = w_enigma.encipher('hellotomweshouldgetbeerorcoffeesoon')\n",
- "ct"
+ "tbt_enigma.set_wheels('a', 'a', 'a')\n",
+ "tbt_enigma.left_wheel.position"
]
},
{
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
- "version": "3.5.1+"
+ "version": "3.5.3"
}
},
"nbformat": 4,
- "nbformat_minor": 0
+ "nbformat_minor": 1
}
projects / cipher-tools.git / blobdiff