Day 6 done

diff --git a/advent-of-code22.cabal b/advent-of-code22.cabal
index 7a73e22557ab17d76e9e4d8d2be64a5f1e8a5f9c..f258fd83010009e0221bede630d572d28eda5ba9 100644 (file)
--- a/advent-of-code22.cabal
+++ b/advent-of-code22.cabal
@@ -119,3 +119,8 @@ executable advent05
   import: common-extensions, build-directives
   main-is: advent05/Main.hs
   build-depends: text, attoparsec, containers
+
+executable advent06
+  import: common-extensions, build-directives
+  main-is: advent06/Main.hs
+  
\ No newline at end of file

diff --git a/advent06/Main.hs b/advent06/Main.hs
new file mode 100644 (file)
index 0000000..02dd902
--- /dev/null
+++ b/advent06/Main.hs
@@ -0,0 +1,40 @@
+-- Writeup at https://work.njae.me.uk/2022/12/06/advent-of-code-2022-day-6/
+
+import System.Environment
+import Data.List
+
+-- test = "mjqjpqmgbljsphdztnvjfqwrcgsmlb"
+
+main :: IO ()
+main = 
+  do  dataFileName <- getDataFileName
+      text <- readFile dataFileName
+      -- print $ part1 test
+      -- print $ part2 test
+      print $ part1 text
+      print $ part2 text
+
+getDataFileName :: IO String
+getDataFileName =
+  do args <- getArgs
+     progName <- getProgName
+     let baseDataName =  if null args
+                         then progName
+                         else head args 
+     let dataFileName = "data/" ++ baseDataName ++ ".txt"
+     return dataFileName
+
+part1 :: String -> Int
+part1 = interestingPosition 4
+
+part2 :: String -> Int
+part2 = interestingPosition 14
+
+interestingPosition :: Int -> String -> Int
+interestingPosition n text = n + (fst packetPos)
+  where candidates = zip [0..] $ fmap (take n) $ tails text
+        packetPos = head $ dropWhile (hasSame . snd) candidates
+
+allDifferent, hasSame :: String -> Bool
+allDifferent cs = nub cs == cs
+hasSame = not . allDifferent

diff --git a/data/advent06.txt b/data/advent06.txt
new file mode 100644 (file)
index 0000000..302ff65
--- /dev/null
+++ b/data/advent06.txt
@@ -0,0 +1 @@
+htsslsmstsrrhlrrllqppfnpnzzqtqtjqttslttmvmsmbbnpbbznzjjmrmsrrnjjzczcfcqchcnnhrnrzrnrzzddtrrpjrprbpbwbswsqswqswsqsqffgngtgwtwbtbbhhslsrsmrmffgcgtcgcppnbpnpbnpptcptpltthjhwwlttrrlldzldzzzlssccrfrqfrfdfldfldfdzfdzzcnznwznzqqzpqzqdzzbbslbljlqjjvzjzgzqgqqqvsvffzjfzfmzzrjrhjhrhcrhhtgtmggchggcsggvtttwmmsspmpffzpfpjjnwwnpwwdttcfcmmlblwlvvqrqddcdwcwnnfqnqdnnncggflfdftddtftqthqhrrmsrmsrsffbccjnnjjgddppjmmldllhttqvqzvzrvrsslnlplrprtprtttnvnsvsvzzdndrnnnlznzcnnzwwzjjsnjnwjwqqczqcqwqppqnqqllgblbhhbbzbjzzwjzzrqzqggdppgcgwcclglhhwwgcccgcvvpbbrzzwszsqqjqrrczzvmvpprllsgstsnnnrvvsszgzddzttbccmjccwtccrbccnssdqsdsqqfgqfqbfqfjqqzqqmhmwhwffsjjcjffqmmwjwhjjqttpvvgddzjdddwndwdjdldgdsdmdzmdzmzqqszzcwwwjbbvvlplnpndnddjcjcttrgrggjvjsjvjssnsmshmhrmhhfvvdqqppmbbjnbnzzzwlzzfmmlttvptvpphlhwhzzwffcsfsppdssvsvgsgcscmmdwwpggtcgttmlmglgmmcsccmmgffnvvvvsscstctptzzcmcsclcffnwwndnwddmgmfmvffntfnndgdrrbmrrvprrjnjcnjjsgjgmmjjjqwqhhlfljfljlclttrgttmdmhhcncwncnmccnmnqqmhmwmdwdmdfdttnggcscfsftttcjchhqghhtdthtwtgwgttlffphfhtftpfttlgtltblljmljjsmsszgsghhnnmvnmnvmvmhvvtmmdqdppclplqljllzppwgpgvpvjpvvlwldlcdcmvfrbcqfdrgqjdmpvczgmtrbhtfgbctjghwfmpqtprlnvzvbmhnmgsnbcqpdqhtstncmtrvwmjzzmsbprfvmszgvdwjwchzcvmzncfblffwvwwrdqpfnvrtlftnvhcqpwfgzdnmpqthblmqzhbdbdhmqvscfrpbjbgjgdndhlnnpcrrmrlghcwvmmmhbvdsrztbpdvhwhsphmgblzfpflhnbrvjsgsbvgcfwdlbmbsmbqfwczhhbbwntsczhljgvdwpsfmjppmdwcfchhvtrwlfgqrzbtzndqwbwqflpthhgtzrfmspfnlrrvrjttwnzzfsbzlvfwlntvcqhfntllsrdgqjdbrbvnmjgfsqshmcgtsmlrzjmmqbpfdfhlghqjnjrcnzvvmbwhwfwpbbsmpdmvvznstqpjwmthncjsvfmbhwtbfqgfmvhhwrwzrzccbmmrngfbcqgsdjlfwrlzqwrbhvhmjzqqtgqvjwgllhhgphjthwnscndjfhrdzjctthwfszztvtzcnvsnfdwnvrrbjzplgnghfsvnflhctjntrpzfgjnfzlmwzrvqcfdqqscrffjshhgmvlgdtqpbllfdspdhcccqbmpqcgctljwzdszbfzsltfmdrcvmjqmpvzzhnczlfdbrmsvfffmfzjvnthghqgtnvjtflzrrnrhqshtzslbmbghvtqcmbdgzcmmrpbtqlzbzjhhgfcbrbcztlhdcfqccqsgdqdfrvlsprbhwhtmjfbzlzfpcslcddzdhbhstvqjgdfwdwzfhrzpthnzgmzrrbrszvcwhbdczzcnqsqrwdpmgdmcdmccmfdwdfmzpbbsdtjlmlvcnvhhgcltwmpzqmjlpbsbfrrntrbmrrmgqrdsbfcgnqvnmwwgnmvvpjzpwbvwfzzfcfrbgdshrvbpdlbpzdsvjnrsmfttqgbngjbqcnhhhmrnlgwjnlfcsdwccqqlzcdrcqnjlmsfqldgdmwlctstcvqbvvwvhvrnhvtgpcnsstnhvlttdnstlndnpdglqlbgggqlwqpfztgzvhqqwbctvgtrmrbpmvwlztsfbrmhhpfdtnsjcjmngsqtzvhqjnwmgcrjbhvghpnrjlrhjfrfrmbzvprpzlcshbqtlnlmqmfhsmbznjmpzwljccngbsvqqmghqsqwwmtqhgddnpcmmlfvmplgptzmfsmpntprnwlpjmsdsntpmpnhwlqgfwslrnjlmvhvqsnlcssvrqvtvfhhghbhnvmpngtdmrcmftjmwgnptbmjcwvrqqbczmtdprlltcjcggvffvjwdthbhvjvhbsmfnstqvczmvsgsqfjmddszzrwnbrbvlhgltjddczwpzpsgfgbtmgmssbszhjfbprpbgsqpvgwfnmpcdwfzwbfbtfwhjbjgrctcwqgfhpvjpjssmcpppwpbnlfsrmbzqdpmpmqjtzqmqswpfhfvfltwnfbltvdmfgmpbhzzdrbtnmmjfqgtrgmrbsgplfrmlnjrggtslngnphcvcwvqsdftlhddhpsdwlhzcrfwgwbndplwjmtrltmswwdqjpgmmcdchllzdgpfpfrvqrmvppvzcrvbswzdclnqnqvmfvjtpzpvzlmbngtrrjwpgqjgrrqbqwcvjlgqzddtcfmmrqtnjppqvztfpdrdmjpsqqvzrhwjgvdwwdtmrzrvhwgsqvjjrtsdtwfwhrbcsqdblhgwzghrqrqtfbzszrmjqbhrtsrcfjlzbcjmdnpthrtbhtzmhgpfcqndwpmtlvzschzzcqdnzdrfhczsrscvttlpslrzgvwprwppmpfjqwhtnhzcdjjwmsnvqzmtlzsdpbdtdtsmbmjszsglrldcsgtnmbgsjfmnrftnmvnjtswrmdthvstmdlsnsmrbqhdlpnmnhjhcccgnzrrsljvwswmhjqrrfbwwhgrcttsdcjsdtlgmgblfnvwmgztbbzlbrdnspfnvwvhzlztdhlzhwwppgwwvrhfbjvrmjpjflqzbdnlvptmrsggqmzgmzlsdzbfqnqzzdnzfgmhncvwmgrcfrmlnwzcwdsvtwbvcqpmgcczbnnfdrlsgnfgnpbdstdmwhlprnzvhjpznsgwhfhzfwmjsvcbwccpsnfgbzrltcbwczcmzwljcswgwjnhwtjrjvgrggsrqszscrjcghnwdzpzhttrjcgwvmtcwmrhvwptlgfjpdjpnhphmzdgfdvsncswbdvjdtsgdtlsgjljlczgrwbswtbwrcfpmhgfjfnhpsmfrrtcjmpvvscmgftpprdmbjwcvhzbrmpbvhgzwftwtvvhrjmljgjhbpnbnfntmjhvjrzwlqbtqlrfbblgmfsbgzhhscgwgzrwvflnfctngtwbvdbbgspntclnbwgpppjgbrlqvtfznpdttrsplvjfsgbjwjprbvdfvjtffbhsjwgbsfschfnmlqdfzmdwzvfctjjvzncdvrdttlpvpgvsssflpfnrzgfznzlldrbgnnztngtlbbrmrmlfnnspsvvsfzfbmsblmzdwqcrftvnbvdlhgdqjtglclpzrchtlffrfwslqjvbfpvnhmdgqrcjtbhmjqwqzpfndqbwldbzmwqsptdccczmhwmdqqzcqvmbbnmqndtspmbtggcghdhsfgrjgvwjdbwmltbhdvdtgqnpqhwmhzpzbqjtnlftqrjbsvtwtgpmvpnfwdtsjgdtfnlntpgrmwphphrrzhbdrbzhtqddwvptdllntjzldzrndhfjwdfnmtjmjtfmndbvlwgmlcmwwlpfdjwbfznbllbmqrlmvljngvpmdlqmvdvwvpqwlbqssqcbnrmhdvrzwljstghmhntwsbqmnlpgthbwmrznbbggthtjhnndnqbzmcrtftcbnpctqjzghdfcvmmvpqwtnntstlspfsgwfdbrlsbwgbhhbfcvwrjclsgmmbqmmjwtdjqppjvcbnbvfwczlqzbtnlhzhssglgnlm
\ No newline at end of file

diff --git a/problems/day06.html b/problems/day06.html
new file mode 100644 (file)
index 0000000..216c718
--- /dev/null
+++ b/problems/day06.html
@@ -0,0 +1,151 @@
+<!DOCTYPE html>
+<html lang="en-us">
+<head>
+<meta charset="utf-8"/>
+<title>Day 6 - Advent of Code 2022</title>
+<!--[if lt IE 9]><script src="/static/html5.js"></script><![endif]-->
+<link href='//fonts.googleapis.com/css?family=Source+Code+Pro:300&subset=latin,latin-ext' rel='stylesheet' type='text/css'/>
+<link rel="stylesheet" type="text/css" href="/static/style.css?30"/>
+<link rel="stylesheet alternate" type="text/css" href="/static/highcontrast.css?0" title="High Contrast"/>
+<link rel="shortcut icon" href="/favicon.png"/>
+<script>window.addEventListener('click', function(e,s,r){if(e.target.nodeName==='CODE'&&e.detail===3){s=window.getSelection();s.removeAllRanges();r=document.createRange();r.selectNodeContents(e.target);s.addRange(r);}});</script>
+</head><!--
+
+
+
+
+Oh, hello!  Funny seeing you here.
+
+I appreciate your enthusiasm, but you aren't going to find much down here.
+There certainly aren't clues to any of the puzzles.  The best surprises don't
+even appear in the source until you unlock them for real.
+
+Please be careful with automated requests; I'm not a massive company, and I can
+only take so much traffic.  Please be considerate so that everyone gets to play.
+
+If you're curious about how Advent of Code works, it's running on some custom
+Perl code. Other than a few integrations (auth, analytics, social media), I
+built the whole thing myself, including the design, animations, prose, and all
+of the puzzles.
+
+The puzzles are most of the work; preparing a new calendar and a new set of
+puzzles each year takes all of my free time for 4-5 months. A lot of effort
+went into building this thing - I hope you're enjoying playing it as much as I
+enjoyed making it for you!
+
+If you'd like to hang out, I'm @ericwastl on Twitter.
+
+- Eric Wastl
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+-->
+<body>
+<header><div><h1 class="title-global"><a href="/">Advent of Code</a></h1><nav><ul><li><a href="/2022/about">[About]</a></li><li><a href="/2022/events">[Events]</a></li><li><a href="https://teespring.com/stores/advent-of-code" target="_blank">[Shop]</a></li><li><a href="/2022/settings">[Settings]</a></li><li><a href="/2022/auth/logout">[Log Out]</a></li></ul></nav><div class="user">Neil Smith <a href="/2022/support" class="supporter-badge" title="Advent of Code Supporter">(AoC++)</a> <span class="star-count">12*</span></div></div><div><h1 class="title-event">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;<span class="title-event-wrap">y(</span><a href="/2022">2022</a><span class="title-event-wrap">)</span></h1><nav><ul><li><a href="/2022">[Calendar]</a></li><li><a href="/2022/support">[AoC++]</a></li><li><a href="/2022/sponsors">[Sponsors]</a></li><li><a href="/2022/leaderboard">[Leaderboard]</a></li><li><a href="/2022/stats">[Stats]</a></li></ul></nav></div></header>
+
+<div id="sidebar">
+<div id="sponsor"><div class="quiet">Our <a href="/2022/sponsors">sponsors</a> help make Advent of Code possible:</div><div class="sponsor"><a href="https://optiver.com/advent-of-code" target="_blank" onclick="if(ga)ga('send','event','sponsor','sidebar',this.href);" rel="noopener">Optiver</a> - Love solving puzzles? So do we! We&apos;re hiring engineers to code trading systems with sub-nanosecond performance. Get ready for daily challenges, continuous learning and the freedom to bring your software solutions to life</div></div>
+</div><!--/sidebar-->
+
+<main>
+<article class="day-desc"><h2>--- Day 6: Tuning Trouble ---</h2><p>The preparations are finally complete; you and the Elves leave camp on foot and begin to make your way toward the <em class="star">star</em> fruit grove.</p>
+<p>As you move through the dense undergrowth, one of the Elves gives you a handheld <em>device</em>. He says that it has many fancy features, but the most important one to set up right now is the <em>communication system</em>.</p>
+<p>However, because he's heard you have <a href="/2016/day/6">significant</a> <a href="/2016/day/25">experience</a> <a href="/2019/day/7">dealing</a> <a href="/2019/day/9">with</a> <a href="/2019/day/16">signal-based</a> <a href="/2021/day/25">systems</a>, he convinced the other Elves that it would be okay to give you their one malfunctioning device - surely you'll have no problem fixing it.</p>
+<p>As if inspired by comedic timing, the device emits a few <span title="The magic smoke, on the other hand, seems to be contained... FOR NOW!">colorful sparks</span>.</p>
+<p>To be able to communicate with the Elves, the device needs to <em>lock on to their signal</em>. The signal is a series of seemingly-random characters that the device receives one at a time.</p>
+<p>To fix the communication system, you need to add a subroutine to the device that detects a <em>start-of-packet marker</em> in the datastream. In the protocol being used by the Elves, the start of a packet is indicated by a sequence of <em>four characters that are all different</em>.</p>
+<p>The device will send your subroutine a datastream buffer (your puzzle input); your subroutine needs to identify the first position where the four most recently received characters were all different. Specifically, it needs to report the number of characters from the beginning of the buffer to the end of the first such four-character marker.</p>
+<p>For example, suppose you receive the following datastream buffer:</p>
+<pre><code>mjqjpqmgbljsphdztnvjfqwrcgsmlb</code></pre>
+<p>After the first three characters (<code>mjq</code>) have been received, there haven't been enough characters received yet to find the marker. The first time a marker could occur is after the fourth character is received, making the most recent four characters <code>mjqj</code>. Because <code>j</code> is repeated, this isn't a marker.</p>
+<p>The first time a marker appears is after the <em>seventh</em> character arrives. Once it does, the last four characters received are <code>jpqm</code>, which are all different. In this case, your subroutine should report the value <code><em>7</em></code>, because the first start-of-packet marker is complete after 7 characters have been processed.</p>
+<p>Here are a few more examples:</p>
+<ul>
+<li><code>bvwbjplbgvbhsrlpgdmjqwftvncz</code>: first marker after character <code><em>5</em></code></li>
+<li><code>nppdvjthqldpwncqszvftbrmjlhg</code>: first marker after character <code><em>6</em></code></li>
+<li><code>nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg</code>: first marker after character <code><em>10</em></code></li>
+<li><code>zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw</code>: first marker after character <code><em>11</em></code></li>
+</ul>
+<p><em>How many characters need to be processed before the first start-of-packet marker is detected?</em></p>
+</article>
+<p>Your puzzle answer was <code>1080</code>.</p><article class="day-desc"><h2 id="part2">--- Part Two ---</h2><p>Your device's communication system is correctly detecting packets, but still isn't working. It looks like it also needs to look for <em>messages</em>.</p>
+<p>A <em>start-of-message marker</em> is just like a start-of-packet marker, except it consists of <em>14 distinct characters</em> rather than 4.</p>
+<p>Here are the first positions of start-of-message markers for all of the above examples:</p>
+<ul>
+<li><code>mjqjpqmgbljsphdztnvjfqwrcgsmlb</code>: first marker after character <code><em>19</em></code></li>
+<li><code>bvwbjplbgvbhsrlpgdmjqwftvncz</code>: first marker after character <code><em>23</em></code></li>
+<li><code>nppdvjthqldpwncqszvftbrmjlhg</code>: first marker after character <code><em>23</em></code></li>
+<li><code>nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg</code>: first marker after character <code><em>29</em></code></li>
+<li><code>zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw</code>: first marker after character <code><em>26</em></code></li>
+</ul>
+<p><em>How many characters need to be processed before the first start-of-message marker is detected?</em></p>
+</article>
+<p>Your puzzle answer was <code>3645</code>.</p><p class="day-success">Both parts of this puzzle are complete! They provide two gold stars: **</p>
+<p>At this point, you should <a href="/2022">return to your Advent calendar</a> and try another puzzle.</p>
+<p>If you still want to see it, you can <a href="6/input" target="_blank">get your puzzle input</a>.</p>
+<p>You can also <span class="share">[Share<span class="share-content">on
+  <a href="https://twitter.com/intent/tweet?text=I%27ve+completed+%22Tuning+Trouble%22+%2D+Day+6+%2D+Advent+of+Code+2022&amp;url=https%3A%2F%2Fadventofcode%2Ecom%2F2022%2Fday%2F6&amp;related=ericwastl&amp;hashtags=AdventOfCode" target="_blank">Twitter</a>
+  <a href="javascript:void(0);" onclick="var mastodon_instance=prompt('Mastodon Instance / Server Name?'); if(typeof mastodon_instance==='string' && mastodon_instance.length){this.href='https://'+mastodon_instance+'/share?text=I%27ve+completed+%22Tuning+Trouble%22+%2D+Day+6+%2D+Advent+of+Code+2022+%23AdventOfCode+https%3A%2F%2Fadventofcode%2Ecom%2F2022%2Fday%2F6'}else{return false;}" target="_blank">Mastodon</a
+></span>]</span> this puzzle.</p>
+</main>
+
+<!-- ga -->
+<script>
+(function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){
+(i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o),
+m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m)
+})(window,document,'script','//www.google-analytics.com/analytics.js','ga');
+ga('create', 'UA-69522494-1', 'auto');
+ga('set', 'anonymizeIp', true);
+ga('send', 'pageview');
+</script>
+<!-- /ga -->
+</body>
+</html>
\ No newline at end of file